Pages : 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886 2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956

  1. Movie Eroi Senza Patria Italian Import DVD NEW 283308631325
  2. A VOIR MAGNIFIQUE PLAQUE PHOTO PUBLICITAIRE PORTRAIT FEMME 141231492433
  3. 10 graines de tomate excellente productivite Muchamiel tomato 202471276226
  4. Toshiba Satellite L555D S7930 New 173 HD LED Glossy 351225675049
  5. Coffret Set repousse piston d%C3%A9trier de frein 352555965597
  6. Autocollant mouton basque lauburu croix gris sticker 4 272612035374
  7. Lg Capteur vitesse de roue JP GROUP 1397100170 283017795316
  8. Vase Baccarat Napol%C3%A9on III d%C3%A9cor florale %C3%A9maill%C3%A9 XIX 283312615436
  9. Clavier 2 touches bouton M A lave vaisselle VEDETTE 302983657924
  10. The Duprees Great Songs of Our Time 142032593922
  11. the JETSONS Capsule Car aerocar CHRISTMAS TREE ORNAMENT 253082141975
  12. Lot E douilles ultra compacte 06cm Lecteur manche %C3%A0 391859407490
  13. Arleston Tarquin Lanfeust De Troy N%C2%B04 312398726882
  14. Nintendo GameBoy Advance jeu Comix Zone cartouche 202431179607
  15. Lot de 3 livres Chair de poule 25 382693753461
  16. Haut fus%C3%A9e DPAM b%C3%A9b%C3%A9 gar%C3%A7on 18 mois TBE 173673088255
  17. Febi 44428 Barre Support Stabilisateur Essieu Arri%C3%A8re 292829303005
  18. The Blacklist Saisons 1 %C3%A0 2 Neuf DVD 362258743381
  19. Daihatsu Hijet White 4 LED Xenon Bright ICE Side 291691221112
  20. Haller Axt Beil Spaltaxt Mittelalter Axtblatt geschmiedet mit 330974993372
  21. BON JOVI 7800 FAHRENHEIT new sealed audio 252603237466
  22. Coton Nouveau N%C3%A9 B%C3%A9b%C3%A9 Gar%C3%A7on Filles Body Barboteuse 531182868154
  23. Caisse %C3%A0 monnaie en acier 25 cm 283298249497
  24. 2X Brembo Coated Disque De Frein Ventil%C3%A9 Avant 142946121686
  25. Halogen Scheinwerfer Set f%C3%BCr Seat IBIZA CORDOBA 6K Bj 113328676162
  26. Lufia the Fortress of Doom Super Nintendo 123140002837
  27. 892 Superbe Ancienne Grande Bobine De Fil En 123501943217
  28. Gute Besserung w%C3%BCnsche ich Dir de Nikolaus Sommer 123570652732
  29. Papier peint La reine des neiges frozen ref1631wm 192093637466
  30. Mener une conversation en anglais de Hathaway Jason 123559071015
  31. Furst Bismarck Otto Eduard Leopold Von Bismarck An 323468246347
  32. 5x Bec Verseur Acier Inox Bouchon Caoutchouc Alcool 332068452705
  33. Lit Bebe A Barreaux Et Matelas 283271466340
  34. 2x 12v 24v Amber Red 4 LED Side Marker Tail 173219226005
  35. protec%C2%AE Grillage cl%C3%B4ture 1m x 25m lacis hexagonal 173271629130
  36. Chico Rita Collectors Edition 3 DISC 201619706943
  37. 10x rouleau de moxa moxibustion soulager la douleur 153044790510
  38. Excelvan M10K6 101%E2%80%9D MTK8321 Tablette 2 16Go Android 60 173679822763
  39. HOMSECUR Syst%C3%A8me DAlarme Maison Sans Fil GSM SMS 143067952244
  40. PORTACHIAVI VESPA CLUB Reggio Calabria 2015 PIAGGIO 143072174762
  41. DRAPEAU DE TABLE FRANCE AVEC ARMOIRIES 15x10cm 272081056198
  42. Champion 1 Candela 8698 Powersport Per Yamaha Yfm 371286497856
  43. Equerre MenuisNobex Octo Pliant 132448052874
  44. Purple Stitch 2X Front Seat Belt Leather Skin 391807687263
  45. OPEL CALIBRA A 20 i 4x4 115 CV 401503209364
  46. cirage MELTONIAN DE LUXE HAVANE NEUF 262853939800
  47. Batterie Yuasa Piaggio Vespa Pxe 150 1981 1997 Yb9 B 202464735470
  48. Nintendo GameBoy Color Spiel Razor Freestyle Scooter 292771861816
  49. cristal de saint louis carafe et 6 verres 382702563293
  50. Komar Photo Murale Urban Jungle Papier Peint Rev%C3%AAtement 143073624900
  51. La Tpv2 Une 2 Cv Citroen A La 283205450414
  52. Kofferraumwanne Antirutsch f%C3%BCr Hyundai i30 CW GD 2012 173697229284
  53. Ernie Ball 2045 Jeu de cordes guitare 142826671643
  54. LP 45 7 TINA TURNER Whats love got 232801990795
  55. Aspire 5 Ply Copper Clad Casserole Pan 113469039922
  56. MARC O%E2%80%99POLO Blouse %C3%A0 manches longues noir blanc motif 173703903182
  57. SMOKIE FOR A FEW DOLLARS MORE 66 1 VG 113445419712
  58. 09 BMW 3 SERIES E90 330d N S Passengers 361900511593
  59. Cars Disney Pixar Mack Trailer Camion Movie 124 302310731132
  60. Superbe Bassine A Confiture En Cuivre 273599351356
  61. R%C3%A9troviseur Gauche El Noir Hyundai H1 0405 %C3%80 173342849686
  62. Led Lenser SEO 7R High Performance Rechargeable Headlamp 202450832969
  63. 2 Essuie Glace Avant Type Aerotwin R Kia 272860787939
  64. MOTEUR CENTRALISATION PORTE COFFRE RENAULT retour gratuit 223106851902
  65. Norev 3 inches Peugeot 508 sw 372536806628
  66. Tenue Costume Ensemble C%C3%A9r%C3%A9monie Smoking Pyjama Grenouill%C3%A8re NOEL 413643698404
  67. Komar Papier Peint Vintage Wood D%C3%A9coration Murale D%C3%A9co 352557262154
  68. Mens Jigsaw Costume Officially Licensed Saw Puppet Outfit 263974963341
  69. Lot revendeur destockage Palette Solderie De 40 Serres 192440245888
  70. CD CLINIC WALKING WITH THEE Neuf et scell%C3%A9 352550098642
  71. maillot de bain short cale%C3%A7on US MARSHALL rouge blanc 152001350669
  72. vintage dinky toys 283306208814
  73. Interruptor de encendido arranque VAUXHALL ASTRA Mk III 253703021482
  74. Timbres Jamaique MNH 273631979395
  75. Tableau Peinture En Relief Sur Du Liege Signee 254029883056
  76. Givi Valise Top Case Monolock B360N For Kawasaki 162866440435
  77. PROMAX CompactMax 2 Transmodulateur DVB S S2 vers DVB T2 avec 163210955115
  78. ECHAPPEMENT imasaf pot moyen mercedes slc Coup%C3%A9 C107 401460798616
  79. AGENDA 2019 Paperblanks GLORIOSA SUPERBA mini giornaliera cm 123479396770
  80. ceinture cuir noire uniqlo 123567928759
  81. De Sap A Spa Un Bolide 2 Cv 283239290196
  82. Designed for Microsoft Windows2000 Se Sticker Aufkleber Case 392201494211
  83. 1PC 18g 16g 14g Acier Chirurgical L%C3%A8vre Labret 563178439345
  84. Coque Capot Arri%C3%A8re Cot%C3%A9 Droit MBK YAMAHA 121276354200
  85. Cuill%C3%A8re Entremets Grand Prix Orf%C3%A8vre Diff%C3%A9rents 262285772600
  86. Lisseur Steampod 20 LOr%C3%A9al Professionnel 132703169551
  87. B Dinky Toys Aveling Barford Diesel Road Roller 401627503998
  88. Opel Astra Mk5 H H3 100w Super Blanc Xenon 132771242571
  89. Live at Wembley de Meat Loaf CD 123549633068
  90. Euroriding Chaps Girona Cuir Portugal 352444597935
  91. RST 1x Entretoise tige stabilisateur avant CITROEN C4 282884590613
  92. Sticker Autocollant Route 66 Reflechissant Casque Biker Moto 190688970024
  93. lot de 2 montres mirroir a restaurer 223295266215
  94. Peinture Etrier De Frein Foliatec Noir Mat Noire 350876705772
  95. 10Pcs Interior Door Card Panel Trim Clips Fitting 192060815342
  96. Coque de retroviseur PEUGEOT 206 a partir de 173422855145
  97. GAS nahtlosen Aluminium Luftbeh%C3%A4lter Kessel Tank Airride 273343068613
  98. %E2%96%AC%E2%96%BA PUBLICITE ADVERTISING AD Montre Watch Jaeger Lecoultre 301722679896
  99. Beau lot de broderies anglaises anciennes 254027821812
  100. Kit Tagliando 4Lt Olio Eni I Ride 10W40 Yamaha 152956065058
  101. Gunpey PSP UK 232697133092
  102. Monopoly Nintendo SWITCH IT IMPORT UBISOFT 322978853358
  103. Lot de 5 Serre tete Bandeau Plastique Cheveux Accessoire 253573320040
  104. Audi R8 Spyder 2012 brillant rouge v%C3%A9hicule miniature 173622254217
  105. Patrick Bruel Ce Soir On Sort Plv 372543266371
  106. G4 5W 15 Smd Led 5630 12V Dc 131694053745
  107. SDWS EN004 Gemini Soldier 1st edition Mint YuGiOh Card 260507719479
  108. Cabinet de curiosit%C3%A9s Enorme Graine de liane de 151955655849
  109. Hommes Croix Pendentif Collier en Acier Inoxydable Lien 621577180900
  110. Genuine Official silicone souple Case Cover Housse Pour 302529168501
  111. Mesure Tape Opp Bimat8X25Mm Sc 143030989732
  112. Noritake Laurel 4 Pain et Beurre Assiettes 5903 192717916462
  113. Baccarat Jeu Jeux De Dorgue Cotes Creuses 6 183575207385
  114. Collier Cuir Prenom Nom Chien Chat Personnalise 6 485161033537
  115. Coppia Pastiglie Ebc Fa367Tt 7320039 Kawasaki 450 Kx 352192639044
  116. Dinky toys GB SB 1 55 Atlantean Bus 273042311624
  117. Moustiers Assiette en fa%C3%AFence %C3%A0 d%C3%A9cor en cama%C3%AFeu 254011662859
  118. Portes monnaies Ancien en Nacre Parfait %C3%A9tat 19%C3%A8me 283314430689
  119. MIKE THE KNIGHT b PERSONALISED PLACEMAT 182197078261
  120. Intermotor Flasher Unit 58940 Replaces 9962228DAC1731PRC88760 335 200 323550377517
  121. Mixeur et batteur plongeant avec support Silencieux 222949575503
  122. Gardevoir EX 111 114 Full Art Ultra 113443382589
  123. Litho Exclusive Spider man Angoul%C3%AAme 2002 Edition Lim DELLOTTO 283290977705
  124. K way X Dsquared2 neuf new black Small 173646105746
  125. C%C3%A2ble conversion USB mini USB REF040 303007787954
  126. Jeu 2 Disques Frein AV TRISCAN PEUGEOT 307 111271763005
  127. Medieval Bodkin Arrowhead 401657869121
  128. Agony Jeu PS4 283298052449
  129. Pour BLEUETTE tenue au tricot semaine de suzette 223251667672
  130. jeu construction bois maison chalet jeu jura 323627919506
  131. Batterie d%C3%A9marrage voiture Fulmen FA640 12v 64ah 640A 172888673865
  132. 471 129 YOUGOSLAVIE timbres surcharg%C3%A9s VUJA STTtrainslocomotives 132666835559
  133. fiche auto 2 CV CITRO%C3%8BN LA 2 271154739621
  134. Hydrovane 140 Air Centre Service Repair Workshop Manual 123566255636
  135. B738 Mount Accessories Rotary Car Vehicle XM Phone 283240696099
  136. disque 45 tours de Stevie Wonder boogie 162900715523
  137. STRADE PERDUTE 2001 DAVID LYNCH ARQUETTE 192594751449
  138. Embl%C3%A8me de Lettrage %C3%89tiquette Noir Voiture Logo Tout 163334576294
  139. Vintage 1980s Adidas Trefoil Tracksuit Bottoms OG Cotton 264035199851
  140. Barri%C3%A8re de s%C3%A9curit%C3%A9 BERRIN TURQOUISE 75 175 581826110320
  141. Febi BILSTEIN Guidon Suspension de Roue %C3%A0 gauche 382479395983
  142. moonrise kingdom 2
  143. 2 grandes bobines bois anciennes 28 x 8 283321496467
  144. Iain Matthews Live At Rockpalast 262604784134
  145. 32 39 12 CM rupture p%C3%AAche 183205133865
  146. nappe de vintage 183514329830
  147. vetement femme fille ensemble veste jupe t 40 312407633995
  148. Jeu wii ANIMAL CROSSING lets go to the 183594965921
  149. DVD PILE OU FACE 292838982442
  150. New PREY Microsoft Xbox 273625707957
  151. 466067 Italie 2 Euro World Food Programme 2004 322564623931
  152. Paire de 5 a pilons Stick Nylon pour 263974269496
  153. torchon ancien 173707992783
  154. Dvds joblot X6 264086578377
  155. Coffret 7 Dvd glee Integrale Saison 1 151599024913
  156. YOUGOSLAVIE 1967 YT 1110 %C3%A0 1115 362521488203
  157. BOSCH Nockenwellensensor Hallgeber Z%C3%BCndimpulsgeber 0 232 103 019 382679893230
  158. Mixeur plongeant Hachoi noir et gris M%C3%A9langeur 223220618716
  159. SOTHYS Embellisseur de teint %C3%A9clat 30ml 163429651220
  160. lecture Homme Loupe de vuePresbytie Demi trame Noir Lunettes 132872643885
  161. Lot PORTE SAVON porte peigne 264080903587
  162. sac Fossil 273613468687
  163. Pendule Art D%C3%A9co En Marbre Et R%C3%A9gule 264066959232
  164. lot revendeur palette solderie d%C3%A9stockage 66 articles de d%C3%A9coration de 163440017915
  165. ancienne boite %C3%A0 bijoux coffret en m%C3%A9tal argente 202539746374
  166. Newsboys 20Th Century Masters The Millennium Collection Us 112674581221
  167. %E2%99%A5 Bolero Fluide Noir Transparent %E2%99%A6 Sia Patrice 311924994428
  168. Coffret compact 39 pi%C3%A8ces de douilles tailles imp%C3%A9riales m%C3%A9triques 202417879360
  169. Lot 1 %C3%A0 50 Tests De Grossesse Pr%C3%A9coce 580397946438
  170. Ex libris Il faut flinguer Ramirez 153320383638
  171. Kit 4 Ammortizzatori Japanparts Ford C Max Dm2 2007 2010 232530351949
  172. salle de bains dacier inoxydable peuplement mur mont 192628370220
  173. digging for fire jp1o
  174. France N%C2%B0 262A PONT DU GARD Oblit%C3%A9r%C3%A9 302990867666
  175. Ancien marteau de cordonnier vieux m%C3%A9tier ancien outil 191832663152
  176. moulinet rare ancien p%C3%AAche mouche ELECTREEL ASTUCIT Louis 323623457689
  177. Art Populaire Ancien Outil De Cordonnier Rarite 254022061375
  178. Super Sanremo 2008 2CD SIGILLATO 321520747881
  179. Tapis Moderne Poils Longs Shaggy Vigo %C3%80 Motifs 591595347944
  180. lot de 11 pendules 292855391028
  181. Ventilatore da Soffitto Scirocco con Illuminazione 102 cm 312298421580
  182. Po 42701 Les Plaisirs De Lenfer Dvd Neuf Sous 272445182605
  183. Bougie Ngk B10Eg 220807074058
  184. Pour FitBit Charge 2 Bracelet de rechange en 472282452525
  185. MACGYVER Stagione 1 Completa BOX 5 DVD in 112698072789
  186. Manteau Chien dHiver Pull V%C3%AAtement Chaud pour Chien 552440835540
  187. PRATT MAGNET FRIGO Lot 6 de 2 192646169889
  188. Universel Support GPS T%C3%A9l%C3%A9phone Portable Fix%C3%A9 A%C3%A9ration Grille 202183180406
  189. Genuine New Apple Watch Sport Band Strap 44mm 264105709863
  190. Casque Gaming pour PS4 Xbox one ST%C3%A9R%C3%A9O Gamer 323578415770
  191. 2 X Sets Nom Pilote Copilote Drapeau 322132323329
  192. Moule %C3%A0 paver pavage manuel fabriquant brique pierre 651414342313
  193. GUNDAM BATTLE CHRONICLE Sony PSP VeryGoodCondition JAPAN 152403482710
  194. Lampe A Huile En Bronze A Deux 230812955596
  195. Ek 1 Cent France S%C3%A9lectionnez une 571720381333
  196. 25 Fiches RJ45 %C3%A0 Sertir pour C%C3%A2ble R%C3%A9seau 260887857364
  197. Ancien petit vase pot %C3%A0 jacinthe en verre 202124829828
  198. Sublime Panier Coupe Vide Poche Decor Floral 163110807989
  199. Lot 5 cordons c%C3%A2bles FireWire 400 2m Or 183330593204
  200. John Lennon Borrowed Time Your Hands POSPG 701 263893628370
  201. Sega Saturn Martian Successor NADESICO with SPINE CARD 361871921048
  202. dvd walt disney stich le film 273589048179
  203. PRISMA Vintage 70 EN SOIE MADE IN ITALY 132640373352
  204. ibanez rg 570 Fm 264051756723
  205. BRAND NEW Pokemon Black Star Promo HOLO 531712107143
  206. Original Brembo Plaquettes De Frein Avant Alfa Romeo 192211219067
  207. Coque iPhone X XS Max XR 2018 Transparente 512505067601
  208. Espagne 2012 2 centimes deuro 201370592797
  209. Players Tom Thumb Full Set History Of Motor Racing 322938436113
  210. Bol chantant tib%C3%A9tain cuivre pour m%C3%A9ditation Yoga Dharma 253295130151
  211. AMG Mercedes W220 W140 CL Alufelgen 85 192756863481
  212. Camp dAUVOURS Lavage des effets 192729778722
  213. Nashville Pianos 16 Super Hits CD Nuovo 173693057155
  214. I adapt%C3%A9 %C3%A0 KIA CEED Housses de 382245171921
  215. 75 Chansons comptines et jeux de doigts de 123551343309
  216. moulinet ancien en bois 192771971196
  217. Cocarde Sticker autocollant rond FRANCE Cocarde tricolore 271532263238
  218. 12m USB 20 Male %C3%A0 FireWire IEEE 1394 302719081170
  219. S34006 DISQUE DE FREIN AVANT SX BRAKING KTM 232829019687
  220. Nelly Furtado Best Of Nelly Furtado 302231877743
  221. Korg Nanokey 2 BK 132635260805
  222. Uncharted 4 A Thiefs End PS4 comme 223176821098
  223. RARE NAPPE NAPOLEON III en LIN SOYEUX FRANGEES 292838923675
  224. Baby Boys Patent Pram Shoes Christening Wedding Baptism 111679839439
  225. GARFIELD T52 B%C3%AAte de sc%C3%A8ne 230992374011
  226. Tenue de Fantaisie Sanglant Zombie Vampire Mariee Halloween 222670977834
  227. Dead Island Definitive Edition Collection 362460090525
  228. Der Pazifik Krieg Vol 2 In Farbe 123531543390
  229. Bosch Gl%C3%BChkerze Duraterm 0 250 212 013 382298522772
  230. Case Poclain 888 B Mobilbagger von Conrad 2893 183592491528
  231. cadre bois dor%C3%A9 ancien XIXe Barbizon 254033687516
  232. MULLER Fr%C3%A8res Lun%C3%A9ville ART D%C3%89CO coupe fer 283308448278
  233. Support Em Metal Chrome Avec Gobelet En Verre 273624319414
  234. Retroviseur droit MERCEDES CLASSE E 124 282751269851
  235. Hummel Slimmer Stadil Duo Oiled High Top Sneaker 432076455053
  236. Arrow Silencieux Ligne Complete Reflex 2 Hom Honda Swt 183025434925
  237. Lot DVD Action 264106759538
  238. GRAND BOUGEOIR ANCIEN EN BRONZE CANDLESTICK 392195565344
  239. 4XSchwarze Fahrrad Handy Halterung f%E9%BB%B5 Apple iPhone 283090794572
  240. 360 Degr%C3%A9s %C3%89tanche Applique Murale %C3%A0 D%C3%A9corations 202548977238
  241. GTA Chinatown Wars PSP NewSealed 223268781796
  242. Ariat Chaps CLOSE CONTOUR SHOW CHAP Cognac 352544535447
  243. 1Pcs 2 Bouton flip distant Key Fob Shell 192583711135
  244. Demarreur RENAULT CLIO II PHASE 3 Campus 123378792867
  245. ATE Garnitures de Frein Audi A3 seat skoda vw Volkswagen Golf 312210693366
  246. Honda Rc30 Vfr750R Tyre Caution Warning Decal 142630193535
  247. hush en route vers lenfer
  248. Antibrouillard Vw Jetta 4 A Partir De 04 2010 282620267597
  249. Carte Pokemon Mmime 37 147 301183811148
  250. Druckluftbeh%C3%A4lter mit F%C3%BC%C3%9Fen Eco Line 11 bar Stahl 322522904931
  251. Boucle %C3%A0 ardillon avec chape et rouleau 262989743907
  252. Used PS2 BANDAI Detective Conan SONY 112712535979
  253. VW Touareg 7L6 Bouton V%C3%A9rrouillage Diff%C3%A9rentiel Barri%C3%A8re Interrupteur 362491161250
  254. 2pcs G10 Couteau Doublure Spatule Mat%C3%A9riel Couteaux %C3%89p%C3%A9e 323623885061
  255. JETON LAITON CHAMBRE DES COMPTES de NORMANDIE 1661 372543590056
  256. Sp%C3%A9cial HALLOWEEN %F0%9F%8D%AC PASANTE MANGUE %F0%9F%8D%AC Pr%C3%A9servatifs x2 581877512016
  257. autant en emporte noel
  258. dvd walt disney stich le film 273633598694
  259. LC Femmes Hommes Punk bracelet sympa en cuir 423555229533
  260. Doudou Peluche Ours Mouchoir Rayures Gris Blanc et 292860397851
  261. Jolie montre pour homme style militaire ou diesel 233029070515
  262. 100 pochettes Ultra Pro Comics Regular Size Bags 183314524744
  263. Ouvre Lettre Coupe Papier En Os 283309763216
  264. bd les femmes en blanc 14 des corps 372549109479
  265. Ex libris Texas Jack 153320390008
  266. Lisseur Cheveux Sinbo 273626833051
  267. Desigual T Shirt Bertin Noir 17WWTKJ8 Knit Top 233059719863
  268. COB LED Flashlight Magnetic Pen Clip Hand 563620345305
  269. CORPS COMPLET Housse Oreiller en forme U Doux 432078349359
  270. Ps2 Jeu Video Playstation 2 Disney Monstres 323624504461
  271. Mini Lame dESSUIE GLACE 3 397 007 637 253284356177
  272. Rms clamp multimeter chauvin arnoux f15 362502180997
  273. 0F Prospekt Prospectus Brochure Catalogue Gamme peugeot 1989 utilitaires 163427566408
  274. Assiette Chrysanth%C3%A8me Chine Style Transition XIXe Si%C3%A8cle chrysanthemum 254022225307
  275. Lot Goodies Conan 3 Tir%C3%A9s %C3%80 Part 143042798103
  276. Jeu Virtua Cop Version Jap Saturn Complet 254039691791
  277. Spiel F24 STEALTH FIGHTERS f%C3%BCr Nintendo DS 323390003253
  278. BOITE VIDE DINKY TOYS CAMION DE POMPIERS 183454548669
  279. POGS V SW TAZ 46 001 Lot de 391778251240
  280. Pokemon Go Deoxys Account Mewtwo Cresselia Shiny 323581368724
  281. KIT PASTIGLIE FRENO POSTERIORI AUDI A1 Sportback 8XA 283232364408
  282. Bras Coud%C3%A9 D%C3%A9port 35 cm %C3%98 48 mm 182950406994
  283. NK Bremsbelagsatz Scheibenbremse 221939 vorne hinten f%C3%BCr FIAT 382690341167
  284. Code du travail %C3%A9dition 2016 Neuf 123493122107
  285. That Thing You Do Bof Bof Cd 281888792876
  286. World Championship Snooker 2003 PC VideoGames 302483772004
  287. femmes rouge strass CZ pendentif collier bijoux Boucles 472116740984
  288. BACCARAT2 verres %C3%A0 eau cristal mod%C3%A8le Talleyrand 273605933220
  289. Zimmermann Disques de Frein 247mm Plaquettes avant 311909041077
  290. Komar Papier peint photo The Good Dinosaur 368%C2%A0x 273194628513
  291. Rotiform Winter Alloy Wheels Snow Tyres 18 392191498596
  292. 4 x Centres Roue Caches Moyeux 75mm Chrome 181484464097
  293. 2 pcs T10 W5W COB Cale Ampoule Voiture 391975637824
  294. BMW 1er 3er 5er 6er 7er X3 X4 322105227544
  295. 56 LED Lampe Solaire Mur Lumi%C3%A8re %C3%89clairage D%C3%A9tecteur 372490137985
  296. prise plexo hager ip 55 132818802707
  297. Nuance OmniPage 18 Pro Electronic Delivery FULL VERSION 113463648459
  298. Robert Talbott Ajust%C3%A9 Boutonn%C3%A9 L S Chemise Bleu 362507114181
  299. STAMP TIMBRE FRANCE NEUF LUXE N%C2%B0 1735a 142422401124
  300. Plat Rond Cordon en Cuir Lacet pour Crafting 372544199443
  301. Land Rover Series IIIII 88 109 90 110 302932970362
  302. Cardan gauche transmission MERCEDES CLASSE A 168 CLASSE 301155515261
  303. Quality Buckingham Deep Induction Stock Pot Stew Pot 361391454593
  304. pyrogene ancien Napoleon III Acier Noirci Bonne Fermeture 332953775476
  305. ANCIENT MEDIEVAL IRON CROSSBOW BOLT arrowhead 153304463166
  306. Profil Aluminium Pour Bandes Strip Led Barre Rigide 162443896894
  307. X Men Bonus DVD TV Serien de Bryan Singer 123530360806
  308. DVD PETIT PRIX Arnaque Le dernier Pari 322371559679
  309. HP 302 Combo 302XL Noir Tricouleur 253388461198
  310. Various Artists Singin in the Rain Original 122305308609
  311. FILTRO ARIA HIFLO DS DOPPIA DENSITA GENERIC 50 352029599914
  312. PS4 Spiel Tom Clancys GHOST RECON WILDLANDS 391801492777
  313. New HP 15 AY071TU LCD Screen Frame bezel Top 152994814004
  314. VERO MODA Blouse %C3%A0 manches longues beige clair 173666854400
  315. Lot de 3 gamelles pour animaux neuves 113433367445
  316. Carte Pokemon Ramoloss 81 123 Reverse 291648295969
  317. Malmo th%C3%A9i%C3%A8re 183304278561
  318. Music Mixer Dj Dance Play Mat Drum Kit 322657593525
  319. Bibliophilie 3 Catalogues Anciens Vente De Livres 1920 28 29 163443895167
  320. 1 Joint DArbre Vilebrequin Payen NA5070 Alfa Romeo 153138976308
  321. Pieges A Taupes Fumigenes X10 Fertiligene 123479108007
  322. 5000LM Zoomable XML T6 LED 26650 Flashlight Focus 113219920164
  323. Universaltopf ca 20L Kochtopf Suppentopf So%C3%9Fentopf K%C3%BCchentopf Topf 163316315236
  324. 12 mm en acier inoxydable Septum Clicker Anneaux 591210640711
  325. Jmt Mf Batterie Ytx9 Bs Kawasaki Zx 6R 600 R 231877256079
  326. Une 2 Cv Citroen Custom Dapparat A 283207122308
  327. Booster Pokemon Ex Emeraude Neuf Scelle 132271939588
  328. Pi%C3%A8ge %C3%A0 rat 4x Pi%C3%A8ge %C3%A0 souris %C3%A0 223176391541
  329. Caroll Robe Bustier En Soie Fr38 Eu36 It42 Us10 Rouge 273441903005
  330. Bosch Aerotwin Wischblatt Set Vorne F%C3%BCr Mercedes M 112481358850
  331. Brother LC127XLBK rendement 1200 pages Cartouche dencre 181511926666
  332. Peluche doudou %C3%A9l%C3%A9phant IKEA Kapplar gris grand mod%C3%A8le 401628271119
  333. TINTIN 9 Le crabe aux pinces dor 283207956496
  334. Relais Secondaire Fil dAllumage Moteur Bernard R%C3%A9f%C3%A9rence 53533 323472155071
  335. Dark Star One Broken Alliance Xbox 360 UK 254012072370
  336. the book of henry l9ld
  337. S%C3%A9rie 6 verres %C3%A0 cognac cristal Daum France 172991651277
  338. n%C2%B08 old tool outil ancien enclumette forg%C3%A9e 311262692635
  339. Keilrippenriemen Satz Riemenspanner F%C3%BCr RENAULT MEGANE I CLIO II 14 16 172721866096
  340. 20x Capuchons protection hexagonal Pour ecrous Roue 17MM 153297718659
  341. SKODA OCTAVIA 14 TSI 122Ch JEU KIT PLAQUETTES 262574572787
  342. Ex Libris Frederik PEETERS Serge Lehman 382704383359
  343. Retroviseur droit MERCEDES CLASSE E 124 152552553662
  344. R%C3%A9gence Vert Moyen Assiette 173681162576
  345. The Witcher 3 Wild Hunt PlayStation 4%C2%A0 153153408642
  346. 18 Pouces Pneus D%C3%89t%C3%A9 Originaux VW Passat 3c 312193837887
  347. Verre %C3%A0 moutarde Zorro 1986 n%C2%B06 walt disney 302543329885
  348. INA Kit courroie de distribution pompe %C3%A0 leau 202296233933
  349. Enfant Fille Chaussures Bottines Bottes Martin Plates Neige 362513904297
  350. 4x BOUGIE DE PR%C3%89CHAUFFAGE %C3%80 CRAYON RENAULT KANGOO 142336490726
  351. 6750415 Leva Freno Di Stazionamento A Mano Bmw 312307024285
  352. Savon au soufre et glyc%C3%A9rine de 125 grammes 123394433000
  353. KIKI DEE CARMELO LUGGERITHE WALK OF FAITHEX EX2 123542632173
  354. Coffret 2 Dvd Il Etait Une Fois En 282935512082
  355. Jolie Robe Femme Rouge Dos Nu TU 163427635656
  356. T shirt Si Papi ne peut pas le r%C3%A9parer 272007725246
  357. W21 5W T20 580 7443 Sidelight DRL Diurne double 223220890704
  358. WMF Topf Set Diadem Plus 5 teilig Edelstahl rostfrei NEU 262273093503
  359. Filo Diaspro Mokaite Naturale Liscia 4 Mm 142809987632
  360. Moulinex Batteur supermix 160 Bol 162840152298
  361. AUTO MOTO n%C2%B0 77 D%C3%A9cembre 1988 OPEL 311409106327
  362. Cangini Filippi Agenda Settimanale 2019 Fantasia Nero Argento 264075749780
  363. Tableau Blanc Aimant%C3%A9 PRO Pr%C3%A9sentation Ecole Conf%C3%A9rence Meeting 521114805426
  364. 1 franc 1943 163381466612
  365. Pj Harlow Amelia Cardigan Tricot Amelia 492867899373
  366. Thermom%C3%A8tre infrarouge %C3%A0 vis%C3%A9e laser digital distance pyrom%C3%A8tre 130896228563
  367. Fifa 14 Ps4 283184615818
  368. Robe en Jean robe en jean %C3%A0 manches 222145339994
  369. Couronne CHANVRE Naturel Longueur 100 m diam%C3%A8tre 12 111427260129
  370. Bougie de pr%C3%A9chauffage Duraterm BOSCH 0 250 403 113414153809
  371. pins pin BADGE MUSIQUE MUSIC ACCORDEON SIGNE TABLO 192571516009
  372. 14x enfant instruments En bois jouet de musique 173692719633
  373. 2 Coussinet Oreillette dEcouteur Casque Pour KOSS Porta 192481662358
  374. Wix Filtron Filtre %C3%A0 huile WL7465 323565459515
  375. Adaptateur 1080p p%C3%A9ritel vers HDMI vid%C3%A9o haut de 153038565427
  376. Rolling Stones 2 Cd No Filter Live 362476842295
  377. Robe de Plage D%C3%89t%C3%A9 Chemisier Longue Chemise Tunique 323574643273
  378. Nap Fap Sic Citro%C3%ABn C Crosser 22 Hdi Des 173301915224
  379. Ensemble 3 pi%C3%A8ces couleur Beige marque Artesan%C3%ADa Roymat 123460558909
  380. Sac Femme Bandouli%C3%A8re Color%C3%A9e 283301433116
  381. Doudou et Compagnie DC chat ours PLAT COLLECTOR 352484438698
  382. Collection Tintin 3 Tomes Tout Savoir Sur Ile 152335648461
  383. Citroen C3 Picasso 55w Super White Xenon HID 302704586982
  384. 7 HD 2DIN Bluetooth %C3%A0 %C3%A9cran tactile voiture 263769280238
  385. Lampe de table mini Super Mario Cube Myst%C3%A8re 302948525522
  386. NAP FAP CITRO%C3%8BN C4 GRAND PICASSO 2 0HDi 173025032400
  387. Bloc Jamaique 1995 MNH 183608666236
  388. Deep Stainless Steel Stock Pot Cater Stew Casserole 142033450705
  389. Wie man zum Stein spricht de Sabine Akiko 123503140232
  390. 10Pcs 24x2mm Caoutchouc joints d%C3%A9tanch%C3%A9it%C3%A9 en anneau detancheite 273358932811
  391. offre DEUS EX humanit%C3%A9 divis%C3%A9 nouveau pour PS4 132899509542
  392. ROWENTA L OREAL CS00126034 reservoir eau fer a 113453705000
  393. Spice World Sony Playstation One Game PS1 264087867716
  394. Rear Driver Side Brake Caliper for Ford Mondeo 291853186706
  395. Reggae Greatest Vol 1 de Bob Marley 123551617962
  396. Baby Girls Boys Warm Cotton Plush Hat Kids Rat Bear 123406128090
  397. Original Nintendo 3DS Console en Aqua Bleu Blue 352526923129
  398. star trek 2 la colere de khan
  399. Metabo Power 250 24 W mobiler Druckluft Kompressor 601533000 302652565217
  400. NGK Remplacement Bougies DAllumage Bobine Set B5HS 273625628766
  401. Lp Grace Slick And Paul Kantner 312295094943
  402. Sonic Forces Ps4 Nuevo Precintado Espa%C3%B1ol Fisico Castellano 163172352383
  403. PhantomPanzer Atari 2600 322344762296
  404. Les sources compl%C3%A9mentaires du droit dauteur fran%C3%A7ais 112630228677
  405. KIT FRIZIONE VOLANO LuK 4 PEZZI AUDI VW 321922457560
  406. WOOLRICH down jacket long parka tt man W0CPS2570 382626317175
  407. conrad case 173715238297
  408. Protection Pare Carter Noir Bmw K1300R K 1300 250945087772
  409. Nhl 19 Ps4 253973055498
  410. Deep Large Stainless Steel Casserole Cook Stockpot Saucepan 400601314534
  411. Officiel DC COMICS femmes Harley Quinn m%C3%A9daillon bi pliable 302635141513
  412. Aimants N%C3%A9odyme 10X2mm ultra puissant N35 PhotoMagnetFimoScrapbooking 282969366586
  413. EBC ressorts dem brayage csk015 compatible en HONDA 332291656745
  414. Orologio Telefono Smartwatch Android Ios Con Sim Bluetooth 162150913415
  415. STUFF4 Phone Case for LG K Smartphone Purple Fashion Protective 690209086907
  416. Rembobineuse de pellicule photo SOMMOR en Bak%C3%A9lite d%C3%A9but 273597899249
  417. 5 CASSEROLES EN CUIVRE VILLEDIEU dessous 202548389206
  418. chaussure bebe 3 a 6 mois 283239780400
  419. Batteria A Gel Yuasa Ytz7S Originale 362155217373
  420. 2x Febi Bras de Commande BMW 5er E39 312210638553
  421. B%C3%A9b%C3%A9 Petit Enfant Pantalon de Neige Combinaison Ski 272454940694
  422. GTA 5 Xbox 360 233039946340
  423. Env%C3%ADo gratis disco de freno ng ondulado 1152x 292504612615
  424. ANCIENT MEDIEVAL IRON CROSSBOW BOLT arrowhead 401657869075
  425. Original Thermostat R%C3%A9frigerateur K59 H2805 Ranco VI112 et Autres 123495687782
  426. Led Haute puissance DRL et Brouillard Lampe pour 302888305625
  427. La Confrerie des Ombres Tome 1 123549780040
  428. 10 preisschildschienen Blanc Etag%C3%A8res 1m neuf %C3%A9tiquette 39mm 401503569885
  429. Kit Tagliando 3Lt Olio Bardahl Xts 10W60 Honda 153206140999
  430. B%C3%A9b%C3%A9 Nouveau N%C3%A9 Princesse Fille T Shirt Haut Long Floral 302947767053
  431. Action Figures DC Comics Batman Classic 401460290658
  432. Bosch Aerotwin Wiper Blades FRONT PAIR SET for 371786098338
  433. simca bagheera 264045342753
  434. Christofle Malmaison m%C3%A9nag%C3%A8re 24 pi%C3%A8ces 12 couverts table 223190459539
  435. MMX9 BATTERIA SIGILLATA MAGNETI MARELLI YTX9 BS CAGIVA Raptor V 322180900390
  436. 2 Clignotants Lateraux Clear V1 Citro%C3%ABn Berlingo Mf 351596224620
  437. South Broadway Athletic Club BOTTLE ROCKETS THE 382543042454
  438. DCUNIVERSE65neufnov2011green lantern 151287670477
  439. Carte postale Rallye Mont%C3%A9 Carlo Historique 2017 Alpine 273628589430
  440. National Kit D em Brayage 2 Pi%C3%A8ces CK10016S 392090543253
  441. Maglia da donna colore nero con stampe e 183268732731
  442. Lot cuivre Saumoniere xxlet bassine a confiture cuivre 192768438450
  443. Jamaica 1991 Columbus min sheet MNH 392198571829
  444. Miroir Glace Degivrant Retroviseur asph%C3%A9rique Gauche Skoda Rapid 122035733078
  445. 1 x Porsche Panamera 970 Turbo II Felge 292878903156
  446. the driftless area
  447. Attelage D%C3%A9mont 7B Faisceaux pour Dacia Logan MCV 182040317633
  448. %E2%99%A6Yu Gi Oh%E2%99%A6 Clerc Psychique du Calme Hushed Cleric HSRD FR050 221901064435
  449. Defi Corde De Rechange Cosmos 30 132804105387
  450. Fiat Fiorino 147 H4 501 55w Tint Xenon 302704057125
  451. Ladies Dress 113492546359
  452. BAPL003 Bobina Accensione OPEL ASTRA H 14 16V 311933125800
  453. 8 Poign%C3%A9e Bouton 2cm Bronz%C3%A9 R%C3%A9tro pour porte 401455057888
  454. Authentique SMOK TFV8 Big b%C3%A9b%C3%A9 b%C3%AAte Ohm R%C3%A9servoir 292642856294
  455. Rear Windscreen Wiper Arm Blade Fits Kia 332484915340
  456. Fiche Marathon Man 1976 Hoffman Keller Schlesinger Olivier 123535212823
  457. Tuyau durite de retour carburant Renault Espace 4 Kangoo 122970880573
  458. 4x Lotus Exige 18 16V Genuine Denso Iridium 361599736175
  459. Statue CHIEN bouledogue Fran%C3%A7ais design multicolore 33 312248671400
  460. code de l%C3%A9tat civil annot%C3%A9%C3%A9dition 2018 Collectif Neuf 132702137983
  461. 2x LED Lampe Lumineuse Bouchon de Valve Roue 660803751111
  462. body lapin pour b%C3%A9b%C3%A9 163427723903
  463. 100Pcs Lot Color Round Mini Led Rgb Flash 253103814053
  464. manteau Toscane taille 463 254009690158
  465. ANCIENT MEDIEVAL IRON CROSSBOW BOLT arrowhead 401657869991
  466. Celine Dion Maestro Sac %C3%A0 main 223295484449
  467. 2 in 1 Stainless Steel Stovetop Pressure Cooker 332323105655
  468. Platine de commande l%C3%A8ve vitre gauche occasion NC246210993 132692284026
  469. 68B407D0 Disco Freno Anteriore Brembo Yamaha Xv S 263203419550
  470. Piano %C3%A9lectronique en Bois pour Enfant piles 262883087558
  471. Chaussons chaussettes b%C3%A9b%C3%A9 Naissance 1 3 283301478284
  472. RH Kit de plaquettes de frein avant CARENS 282857931695
  473. destockage foulard %C3%A9charpe neuf mousseline de soie grise 302833670798
  474. LC EC Mini Tactique LED Lampe Torche Foyer 423769646723
  475. BG3661 Brake Disc Front Axle DOUBLE PACK 352411778496
  476. Diesel CRDi CR Common Rail Power Box Chip 132609714966
  477. John G Hardy Hommes Cravate Soie Vert Fonc%C3%A9 173642478208
  478. le cheval de saint nicolas
  479. 100x Composants C%C3%A9ramique Bo%C3%AEtes %C3%A0 Fusibles Auto Accessoires 192058759711
  480. 2004A 2 Euro C0Uleur Italie 222831019011
  481. Melody On The Move Std 8mm Sound Film 264110706919
  482. Mercedes S Class W221 H7 55w Super White Xenon 292522538686
  483. N%C3%89ERLANDAIS Drapeau HOLLAND Vinyle Sticker Autocollant 100mm x2 322085300571
  484. Pipercross Luftfilter BMW 5er Touring E61 525 xi 332534933208
  485. Cousances cocotte en fonte Cocotte avec couvercle 303009124332
  486. Interglass Italy Ensemble de 6 Bleu Marine Cristal 153259765112
  487. Coppia Dischi Freno Ant pos Fiat 500 C 312 273299004083
  488. Azzaro Pour Homme Coffret Cadeau Homme Neuf 323441118371
  489. %C3%89querre ding%C3%A9nieur 250 mm 132846772693
  490. Sricam 720P HD Mini Wlan CAM Wifi IP 323591060855
  491. Piercing %C3%A9carteur doreille spirale 172963290449
  492. Cartoon Chat Boucle dOreille Mignon Animal Pendentif Dangle 413506865172
  493. Anello Oro Rosa Bianco 750 18K Fascia Cuori 372527652634
  494. Disque De Frein 21121 253632626364
  495. Neuf 8GB Full HD Cam%C3%A9ra de Surveillance en 183357758878
  496. Jolie paire de petits boutons de manchette couleur 192758177666
  497. ancien bec verseur liqueur benedictine 202552161715
  498. pi%C3%A8ce de monnaie pendentif 800er argent 50 Schilling 323166500357
  499. Reproduction de badge dacc%C3%A8s Urmet 143015861819
  500. 4 St%C3%BCck YOUS Original Gl%C3%BChkerzen FORD FIESTA IV 321533237453
  501. Catalytic Converter PEUGEOT 108 12i VTI 12V 82 173079657963
  502. Walser couverture de survie 160 cm x 210 283276584357
  503. Album La Semaine De Suzette Nouvelle Serie 232922755486
  504. SET DE 2 FEUX DE JOUR DRL LED 111317677876
  505. Ford Fiesta Mk2 16 Xr2 Cvh Brand New 270790431276
  506. DINKY TOYS MODEL No128 MERCEDES BENZ 600 PULLMAN 401629794386
  507. MANN Filter Paket Liqui Moly Klima Fresh f%C3%BCr Citro%C3%ABn 401623649150
  508. Weber Carb carburettor 32 36 Dgv 5A New Genuine Ford 151460174197
  509. Tres Elegante Veste Legere T46 113490196016
  510. ZIMMERMANN Bremsbel%C3%A4ge Bremskl%C3%B6tze CITROEN C4 II DS4 DS5 360914203601
  511. Spr%C3%BChdose Haftgrund Weiss 500ml f%C3%BCr Autolack 112027393459
  512. Droit dauteur et droits de lHomme 112614282298
  513. MOOG Triangle Bras de Suspension Avant Droit Pour 223216586800
  514. 2 Eclaireurs Retroviseur Exterieur Led Vw Golf 5 112105255120
  515. Anet A8 Druckplatte Glasplatte Druckbett Dauerdruckplatte Spiegel Fliese 292893273094
  516. Audi A6 Allroad 4FH C6 200411 avant Droit 332859391777
  517. Jeu Ps3%C2%A0Gran Turismo 6 332958026011
  518. Batteur mixeur et m%C3%A9langeur universel Robot patisserie 222928903274
  519. BMP180 Digital Barometric Pressure Sensor Board I2C 563212229656
  520. Ch%C3%A2telaine %C3%A9maill%C3%A9e de montre ancienne En Argent Massif 113307181384
  521. GONN Time Travel 50 Years Come Gonn 282271788651
  522. Gros lot de 33 Jeux XBOX 360 173707906595
  523. SEGA MS Master System Spiel Olympic Gold 263960637303
  524. Affiche Ancienne Sunday World April Vintage Poster Circa 202059553216
  525. Clip en cheveux humains Frange Micro Volume Frange 352409708402
  526. NEW Hunting Simulator and Farming Simulator Nintendo Switch 323618430496
  527. D%C3%A9marreur occasion LAND ROVER RANGE ROVER44I V8 32V 112855391610
  528. 2Pcs Blanc 3LED 5630 18mm Miroir Concave Aigle 401631095809
  529. Lampe De Poche Torche %C3%80 Led En Aluminium 142896962508
  530. Pr%C3%A9sentoir Porte Bijoux 3 Rangs de Boucles dOreilles 621632130067
  531. Perroquet Oiseau Tasse %C3%A0 Caf%C3%A9 Tasse %C3%A0 Caf%C3%A9 362516788052
  532. CRASH TEAM RACING CTR for SONY PLAYSTATION 1 273520145932
  533. High Speed 4 Port USB 20 Multi HUB 273494952626
  534. Costume diablesse rouge Obsessive 222711551788
  535. DISCHI FRENO ANTERIORE STARLINE PB20312 VOLKSWAGEN GOLF 20 302440065619
  536. 2 Cache Protection Serrure Citroen C4 Ii 123518691124
  537. city of ghosts
  538. mercerie ancienne lot de fil de lin 254031059346
  539. Robe bustier BCBG MAXAZRIA T 38 192745961616
  540. MITSUBISHI GALANT 96 06 Ground Zero Haut Parleur BOXE 165mm 401509455016
  541. NBA Live 14 PS4 Neu OVP 192169782715
  542. disque 33 tours X 2 STEVIE WONDER 163360086284
  543. Audio Cd Jeff Healey Band The The 232969250900
  544. Neuf Mignon pour No%C3%ABl Cadeau de No%C3%ABl P%C3%A8re 601909731057
  545. Cristal de SAINT LOUIS verre %C3%A0 digestif OVERLAY mod%C3%A8le 173690250083
  546. Toyota Hilux Mk7 KUN 30 D 4D 04 15 163 162957955587
  547. Coque retroviseur droit Skoda Octavia 01 2009 2013 a peindre 302941394663
  548. Vauxhall Vectra MK1 B 17 TD 193mm Thick Genuine 362243980424
  549. LG K11 black schwarz 16GB LTE 4G Android Smartphone Handy 192721246735
  550. Vileda Windomatic Power spray Set aspirateur vitre 163419740825
  551. 2x BOSCH Disques de Frein Avant Ventil%C3%A9 320mm 232992512144
  552. COPPIA DISCHI FRENO ANTERIORI BMW 5 E39 528 282958461317
  553. lot revendeur palette solderie Destockage De 150 Ferrero Rocher Dlc 192335510364
  554. Tunique femme taille 42 44 173681880256
  555. My Hero Academia PVC Action Figure Toy cadeaux 601844335135
  556. DEFI CORDE DE RECHANGE COSMOS 30 m w0i 292852118712
  557. BOSCH CAPTEUR AIDE AU STATIONNEMENT ARRI%C3%88RE 0 263 183315097427
  558. Jeu Lemmings 2 The Tribes Nintendo Game Boy 223218402007
  559. lhomme aux poings de fer 2
  560. Coincard 2 euros comm%C3%A9morative BELGIQUE 2017 200 382014338923
  561. 9 ANIMAL RIGHTS VEGAN Badge Magnet Keyring or 552365660812
  562. Mylene Farmer PLV OFFICIELLE INTERSTELLAIRES 183609419548
  563. Perceuse Sans Fil Hitachi Ref Ds 14Djl 123546198633
  564. BeMatik Bracelet Antistatique pour r%C3%A9parations Contre Les 382657290190
  565. Pendentif Quartz fum%C3%A9 Pierre polie 223160609745
  566. Vauxhall Meriva 03 09 Rear Fog Light Lamp Right 263024515429
  567. Oreiller Balle dEpeautre Bio 50x70 cms 251164611618
  568. 50x En Bois B%C3%A2ton Langue D%C3%A9presseur Cirage Spatule 222556127265
  569. NOUVEAUTE flacon neuf GABRIELLE en Eau de 173704438742
  570. Liquide de refroidissement universel 25%C2%B0C 5L 273553126728
  571. Liebherr Chargeur Sur Pneus L 531 Conrad N%C2%B0 163454234463
  572. Luftfilter Hiflo Honda GL 1500 Goldwing SC22 89 90 263891671686
  573. Drone Quadricottero Radicomandato Wifi 24G Camera Hd X5Sw 1 253881290487
  574. everything beautiful is far away
  575. BMW SJ 219 Avant Sport Japon Tarox Disques De Frein 292148587826
  576. T%C3%A9l%C3%A9rupteur silencieux Legrand C%C3%A9liane blanc complet 67061 68003 80251 66631 150788908873
  577. LOT DE 5 Bloc de secours %C3%A0 223274762603
  578. RH 2x Disque de frein arriere VW GOLF 282901594073
  579. Tr%C3%A8s El%C3%A8gant Tailleur Robe 254039623479
  580. SteamOne H190B D%C3%A9froisseur %C3%A0 Vapeur Vertical Noir 1900 123571240894
  581. SKF Generatorfreilauf VKM 03657 f%C3%BCr FORD FOCUS 3 382677682498
  582. LAFFAIRE LOUIS XVI P A Bourson 2000 161582481468
  583. Sucrier ou bonbonni%C3%A8re en opaline verte 132900033856
  584. Jupe Ecoli%C3%A8re Pliss%C3%A9 Carreaux Spazm 323583977353
  585. WK136L DISCO FRENO ANTERIORE SX BRAKING MV AGUSTA 152825834681
  586. 10 x perles oeil de tigre rondes naturelles 264083862230
  587. Miniature eau de toilette BIBI de Jean Barthet 113259110008
  588. baby boy Next winter coat age 9 12 months 183558460159
  589. Designer Mens Leather Wallet RFID SAFE Contactless Card 302187109803
  590. Carte Yu gi oh VanDalgyon le seigneur du dragon des 153280859421
  591. 2 Lampadine H1 White Vision Philips Seat Ibiza 253879637352
  592. P95548 Yougoslavie Yugoslavia Sg 392197449780
  593. 2 Ampoules Led Bmw X5 E53 Z8 Bax9S 382039608476
  594. Front ABS Wheel Speed Sensor Land RoverRANGE ROVER 123453813152
  595. green post end cap round plastic fence accessories 113165685203
  596. Porte Cl%C3%A9s Tour de Cou Logo RANGE 152095297626
  597. BD DESSIN HUMOUR PRESSE JEAN BUZZINI dit BUZZI 302311724135
  598. Coppia Paraoli Forcella Originali Ariete TC4 352163246887
  599. 481010625628 Pompe De Lavage Skit Smart Perm 253056528278
  600. %C2%A0WOMENS LADIES leather THIGH%C2%A0 HEEL OVER THE KNEE 254033986701
  601. mardock scramble film 2
  602. 1 litres Castrol power 1 racing 4t 10w 40 351674804871
  603. Plaque dimmatriculation Colorado VS 711 Us Usa license 183604132076
  604. H4 Gread 60 55W 8500K Optiques au X%C3%A9non Lampe 323199737726
  605. The Sight de Paul WS Anderson DVD 123479990286
  606. Dexlan Dexlan switch 24 ports gigabit avec 2 232760057578
  607. Coque Pour iPhone X 6s 7 8 Plus 113367515736
  608. Nike AIR JORDAN Space Jam Baby 3 piece Outfit 123270846743
  609. Sudocrem Antiseptic Healing Cream 125g BRAND NEW 332431721638
  610. John Wayne 8 DVD Bundle BRAND NEW 253283240415
  611. 1 split
  612. Columbia Sportswear National S%C3%A9curit%C3%A9 Administration Veste Nsa USA 163374384079
  613. Robe CAROLL 44 pied de poule noir blanc 254039330772
  614. Wall Rogue Slate Wall Wallpaper Mural 24m x 132625826421
  615. NOIR FORD Ceintures de S%C3%A9curit%C3%A9 R%C3%A9glable Stop Boucle 351914538758
  616. 33 2128 KN Air Filter For VW Golf 141587151042
  617. 4 Bougie WR6DC BOSCH Super FIAT TEMPRA 159 351046662340
  618. Lot 25 Dvd 273626868528
  619. R%C3%A9troviseur Dx El Terme Ribal C feu 9 Broches 202322597272
  620. Hot Off White Tie Down Yellow Nylon Cotton 202534518358
  621. Collier de serrage Rilsan incolore noir 120 150 200 300 368mm 10 461524703610
  622. Lot 8 figurines en plastique crescent toy mexicains 392110785985
  623. dvd lot de 10 bon films 303004470721
  624. Eon 1 43 Scale James Bond 007 Austin Cambridge 232259273454
  625. 2x GAS Pression Amortisseur Avant Audi A3 A3 351371422388
  626. BBK Transmission Ryan Gosling Sixi%C3%A8me 16 Figurine Miniature 163343322290
  627. Quiksilver%E2%84%A2 Mapool Maillot de bain pour Gar%C3%A7on 123494070211
  628. Yes Tales from topographic oceanslp double 382542346482
  629. 1 %C3%A0 10 pcs condensateur MKP X2 310V 472323191106
  630. CLAUDE II LE GOTHIQUE 268 270 antoninien Rare 252097898008
  631. Gioachino Rossini La Cenerentola DVD Teatro Carlo Felice 361481925233
  632. Ensemble B%C3%A9b%C3%A9 Fille Taille 6 Mois Robe Rouge 401631182775
  633. John G Hardy Hommes Lin Cravate Soie Beige 302967509844
  634. Tactique Tomahawk Militaire Hache Engineer Arm%C3%A9e Camping plein 362516762715
  635. Nintendo Wii jeu Bratz Girlz Really Rock 382592323516
  636. Trag F%C3%BChrungsgelenk f%C3%BCr Radaufh%C3%A4ngung Vorderachse OPTIMAL G3 070 162988156091
  637. Tucano Urbano R019 Coprigambe Termoscud%C2%AE Per Sym Symphony 153254520979
  638. CHYPRE 2018 10c 20c 50c 292893673895
  639. d%C3%A9guisement De Carnaval par poup%C3%A9e lingerie sexy cosplay 323548571552
  640. 10x Ampoule Baionnette BA9S LED Blanche 12V Feux 201377984303
  641. Nike Air Max 90 Ultra 20 Cuir Baskets 631657952470
  642. Pince %C3%80 Sucre Forme Crabe En M%C3%A9tal Argent%C3%A9 254010103056
  643. Mini Switch Ethernet D Link 8 ports 10 100 Mbps 401676524204
  644. 2 Euro Commemorative Circ Allemagne 173661698800
  645. Scheinwerfer links Peugeot 307 01 05 Limousine SW Break Valeo H1 H1 H7 323617021862
  646. Dress It Up Buttons COOKIES CUPCAKES CHRISTMAS 651432192985
  647. Attelage Audi A6 Berline 01 97 04 04 Col de cygne 192687153889
  648. going to brazil
  649. Guitare autocollant sticker adh%C3%A9sif Taille8 cm couleur 162700578473
  650. 33 Tours Telephone Au Coeur De La Nuit 192752673869
  651. gaine 3d zen masturbateur masc de TENGA 264069868141
  652. %E2%99%A6Yu Gi Oh%E2%99%A6 Andabata Bete Gladiateur BLLR FR022 VF Ultra Rare 322577246680
  653. BERU Z%C3%BCndkerze Z26 Z26 252315476971
  654. Kit 4 Ammortizzatori Ant Post Fiat Doblo 252313630028
  655. Poids de comtoise Foret Noire R%C3%A9gulateur 254020688287
  656. 6215022 Pastiglie Freno Malossi Yamaha Yzf R Thundercat 182353948582
  657. 2 PU 14 350 8 Metal Wheelbarrow Wheel 173591880059
  658. PETIT BATEAU Robe grise fonc%C3%A9 et clair %C3%A0 202355283923
  659. POMPE POMPETTE POIRE D%E2%80%99AMOR%C3%87AGE HYUNDAI Porter 24 25 401313855817
  660. Boitard 1851 LE%C3%87ONS SUR LE CODE DE PROC%C3%89DURE 400991554359
  661. 20 Hexagonal 19mm ECROU BOULON DE LA ROUE 173662223174
  662. Plaquette de frein Kyoto Scooter MALAGUTI 400 Madison 352370036581
  663. Balai dessuie glace SWF 116351 avant 312240633272
  664. John Williams A Life In Music London 382497978131
  665. Femmes %C3%89lev%C3%A9 Taille Afflig%C3%A9 D%C3%A9chir%C3%A9s Toile De Jean 671376675880
  666. Bougie NGK D10ES 282336892749
  667. Si%C3%A8ge auto Gr 1 9 18 kg Juno 2 Fix 401493360944
  668. Wedding Day Toasting Bride Groom Champagne Flutes Mr 332714500957
  669. JANTES ROUES MAK WOLF MINI CLUBMAN COOPER SD 382440670873
  670. TROTEC BM12 Humidim%C3%A8tre Testeur bois et mat%C3%A9riaux 372478807629
  671. Statue Sculpture Elephant Animalier Style Art Deco Bronze 222828615776
  672. 4X 18W LED Lampe de travail Lumi%C3%A8res de 202448676717
  673. For Amazon Kindle Fire 7 HD 8 2017 282668555460
  674. ANCIEN RASOIR GILLETTE ouverture PAPILLON METALMADE 283316332317
  675. le trou noir
  676. DISQUES SPORTIFS TAROX Sport Japan PLAQUETTES VW 263948898608
  677. Glace et Porte Miroir PEUGEOT 307 2001 322873029153
  678. Komar Photo Murale Star Wars Blueprints Papier Peint 401676371696
  679. Vase en verre %C3%A9maill%C3%A9 Art D%C3%A9co JOMA 322068682966
  680. Saint Seiya Artbook Anime Special 1 253958395775
  681. DINKY TOYS MODEL No128 MERCEDES BENZ 600 PULLMAN 401629793136
  682. 50X T10 168 194 W5W blanc 28 SMD 292420633825
  683. WHIRLPOOL Platine De Control Ref 461950248992 312236320889
  684. Sfpf7018 Filtro Carburante Benzina Fuel Filter Starline Citroen 302440122414
  685. Doudou Max Et Sax Ours Rose 264102833324
  686. MENS WATERPROOF SKMEI DIGITAL SPORTS WRIST WATCH Water 302991268167
  687. lauberge rouge
  688. Ecole Flamande vers 1580 Atelier du Ma%C3%AEtre du 264021741277
  689. Peinture etrier Bleu RS Kit nett FOLIATEC pour ALPINA 351772641017
  690. 1 sticker plaque immatriculation auto DOMING 3D RESINE 230954850528
  691. Siege De Paris N%C2%B036 Paris Etoile 3 Pl 202546182673
  692. ORIGINAL Fensterhebermotor vorne rechts MERCEDES BENZ C CLASS W204 282893575422
  693. Quiksilver%E2%84%A2 Highline Gen X 19 Boardshort pour 123554499917
  694. ROUSSEAU Jean Jacques Les Confessions Illustr%C3%A9 par Calbet 1934 Num%C3%A9rot%C3%A9 173296346244
  695. L 2017 Persia In Honour Of Ayatollah Hashemi 223290055080
  696. Boku no Hero Academia My Hero Academia Can 323533715445
  697. Tee shirt %C3%A9t%C3%A9 fille 2 ans v%C3%AAtement 323238761680
  698. cale nuque chauffant en noyaux de cerise 163385619392
  699. 38 40 Nuisette Nuit Deshabille Neglige Saut Lit 264082819699
  700. simca bagheera 264091819886
  701. Project cars 2 version promo ps4 playstation 273625973295
  702. maillot de bain homme 132904464993
  703. CAPSULE DE CHAMPAGNE 372550560675
  704. PI Renault Clio Mk3 2005 onwards 12 petrol 380683448694
  705. Une Pince A Sucre Argent Massif Poin%C3%A7on Minerve 233064432834
  706. Massey Ferguson Kit Embrayage Complet 133 135 331927314620
  707. Simca 1300 1500 Feux Clignotants Neuf Pk 113395147822
  708. cherchez la femme
  709. SAC KAPPA WA401S SAFETY SET SALUT VIS PNEU 1690 352312541207
  710. FR Squelette Montre Automatique M%C3%A9canique Homme en Acier 522035755786
  711. Edision HDMI Modulator single HDMI auf DVB T Wandler 291146902157
  712. Mousse De Polyurethane Pour Squishy 283302594982
  713. Dinky Toys France Renault 12 263288226402
  714. Lot DVD Humour 323622679983
  715. DVDMr and Mrs SMITHbrad pittangelina jolie 162883142383
  716. DINKY TOYS MODEL No128 MERCEDES BENZ 600 PULLMAN 401293317890
  717. Affiche Pli%C3%A9e 120x160cm KNOCK 2017 Omar Sy Ana 232989169948
  718. cable WL Gore Associates pour Switch QSFP 332730443412
  719. specchio retrovisore elettrico destro Alfa romeo 147 253866563414
  720. Favstina 161 164 Sesterce Bronze 283311116464
  721. Fits Peugeot 5008 16 HDi 110 Genuine Apec 302772173737
  722. 2Pcs Universel Poign%C3%A9e couvercle de casserole recharge bouton 322386952827
  723. Portmeirion The Very Hungry Caterpillar Sectional Tray Storybook 192618816361
  724. 2x AMPOULES H4 RAINBOW SPECIAL PLUIE TOYOTA CAMRY 151994885646
  725. Le Guide des Comics Heritage 202548488915
  726. DVD S%C3%A9rie Smallville Lint%C3%A9grale de la s%C3%A9rie 223299147375
  727. Housses de si%C3%A8ge Gris et Noir Lavables 223226683590
  728. Camions Dinky Toys 283290008724
  729. SOY LUNA Mega pack de tatouages 3 362203524612
  730. 1x BOUGIE Dallumage NGK CR8E 1275 263104814103
  731. Skf Courroie Crant%C3%A9e Dent%C3%A9e Galets Pompe 142409339645
  732. FILTRE A AIR DAIHATSU CHARADE IV 15 i 112856282082
  733. Nutritional Analysis of Dioscorea alata Nutritional Information on 231861787498
  734. Interrupteur va et vient Double blanc Schneider Odace 183432275772
  735. Kit Box X Priv 225W Smoktech TFV12 Prince Smok 563538039045
  736. Intel inside CORE i5 Sticker Aufkleber silber 221626709860
  737. Coconuda Abito Miniabito Vestito Collo Sciallato Ampio Caldo 553243383845
  738. HIFLO HF198 Filtre %C3%A0 Huile Neuf 332862635745
  739. CASE IH Tracteur Contacteur a cl%C3%A9 233036638718
  740. henri 4
  741. USED %E2%80%8B%E2%80%8BPS4 DJMAX RESPECT Japan 123508743296
  742. BY4127 DISQUE DE FREIN AVANT SX BRAKING SUZUKI 232829065769
  743. 20 pi%C3%A8ces Poulie %C3%A0 gorge en V Roue 183579346951
  744. 24PCS pp ABS PE PVC 173281430883
  745. Bandai VIRGO SHAKA GOD Soul of Gold VERGINE 252657700140
  746. L%C3%A9vy Bernard Henry Les Aventures De La V%C3%A9rit%C3%A9 Peinture Et 272814823171
  747. 1995 Fleer Ultra X Men Chromium Alternate X Lot 282722350245
  748. Brand New Purflux Air Filter A201 253086766426
  749. LOT 2 DVD karaok%C3%A9 362494204134
  750. toi et moi et dupree
  751. Catalytic Converter PEUGEOT 2008 12VTi 12v 82bhp EB2FHMZ 173348104836
  752. Dell Latitude E6430 ATG Simple E Port R%C3%A9plicateur II 401660184379
  753. Andr%C3%A9 Gide la symphonie pastorale Le Livre de Poche 282186489322
  754. Nina Simone LITTLE GIRL BLUE JAZZ AS PLAYED 371204613358
  755. centimes deuro Chypre 2012 1 2 et 5 264100761985
  756. marmite bourgeat petites collectivites diametre 36 332967499604
  757. 2 en 1 Stylo Crayon %C3%A0 Sourcils EyeBrow 492359472762
  758. Quiksilver Mapool Allover 372365294867
  759. Dacia Duster 16 Logan 2010 Filtro Aria Fk 361467036890
  760. FILTRE FIN de lave vaisselle BOSCH en parfait %C3%A9tat 273598977155
  761. Michael Jackson This Is It The Music 381317058407
  762. Pochette joints neuf BOSCH pour pompe %C3%A0 injection 272016454882
  763. plateau en cuivre cisel%C3%A9 de 59 cm de 153207133920
  764. Das Verm%C3%A4chtnis der Wanderhure Alexandra Neldel 273485533612
  765. Kit Poly UV Gel de Construction Faux Ongle 283256502382
  766. Vitre protection Film protecteur %C3%A9cran VERRE TREMPE HUAWEI 512311203518
  767. Disque de frein Flame arri%C3%A8re fixe homologu%C3%A9 Husqvarna 263853378611
  768. DINKY TOYS MODEL No128 MERCEDES BENZ 600 LIMOUSINE 302351988764
  769. Perforateur Burineur Parkside 273561136242
  770. KIT TAGLIANDO 4 LT OLIO MOTUL 7100 15W50 401390495994
  771. Musique rock forever 1 Badge 56mm Button 173675081847
  772. Revell Rarit%C3%A4t BMW Isetta 250 die Knutschkugel 123481520907
  773. EBC arri%C3%A8re carbone TT PLAQUETTES DE FREIN YAMAHA 292259835710
  774. Allumeur Ducellier Neuf Renault 6 Tl R1181allemagne R 141440978274
  775. Hydrovane 13 17 23 Service Repair Workshop Manual 97 Pages 123566255396
  776. Daniel Barenboim Beethoven Piano Sonatas Volume 2 173386188897
  777. ATE Garnitures de Frein avec Indicateur D Usure 292672997248
  778. AncienPo%C3%AAle Plat %C3%A0 oeufs cuivre %C3%A9tam%C3%A9 Anses en laiton 143063171969
  779. Carte Yu Gi Oh BOXEUR INDOMPTABLE AMBIDEXTRE MP14 FR005 172470239295
  780. Calandre avec logo embl%C3%A8me pour Volvo V50 MW 04 07 132702922387
  781. Retroviseur Electrique Degivrant Droit Citroen C4 Picasso 2007 2013 272120560393
  782. THOMPSON TWINS 10 promotional posters collectable 391924063313
  783. ann%C3%A9es 1950 VINTAGE COUTURE MOTIF robe bol%C3%A9ro B34 262124724932
  784. Fil %C3%A9lectrique souple HO5 7 VK 05 075 1 15 25 mm%C2%B2 5 10 15 20 m 561872707148
  785. Kit Dentretien 4 Lt Huile Motul 7100 10W50 372169623940
  786. pour Citroen C4 16 HDI 20 HDI %C3%A0 302457265962
  787. PS4 Pro Refroidisseur Ventilateur Turbo 5 Cooling 153116124083
  788. Mia Germany MX 3069%C2%A0 Batteur %C3%A0 main 322507348138
  789. Morrison Duets Re Working The Catalogue Us Import Cd New 113386546456
  790. Autocollant Coccinelle voiture dos Bretagne Breizh sticker adhesif 162700578058
  791. Plaque M%C3%A9tal T%C3%B4l%C3%A9e Vintage GARAGE Hell Bent For 263992721793
  792. lot de deux dinky toys type 2cv 143051812807
  793. Ex Libris Meynet Double M Mirabelle 352346846600
  794. Clignotant Avant Left Blanc Peugeot 405 I Ph1 152471790488
  795. M Audio keystation 61es keyboard boxed 99p start 143068547771
  796. Animalerie v%C3%AAtement costume d%C3%A9guisement tee shirt pour chien P%C3%A8re 584065791197
  797. 1 cocotte faitout avec couvercle en acier 3L 132897597271
  798. London Twilight Orchestra plays The Story of Dire 123546256672
  799. D%C3%A9bitm%C3%A8tre masse air Mercedes E Class T Model E 350 232745566263
  800. Peugeot Boxer 2006 RETROVISEUR %C3%A9lectrique GAUCHE SHORT CHAUFFANT 142655315251
  801. The Lost World Jurassic Park Sony PlayStation 1 2 163325120195
  802. Lot 1998 Skybox Marvel Silver Age Alex Ross 282889961713
  803. Wholesale Genuine SWAROVSKI 2058 2088 Flat Backs 640921994177
  804. 4X 16 Inch Rapide Nc Wheel Trims Cover 323553983966
  805. 2560%E2%82%AC 1l Adler Metallgrund L%C3%B6semittelhaltig Innen Au%C3%9Fen 25L 123505320882
  806. DINKY TOYS MODEL No128 MERCEDES BENZ 600 LIMOUSINE 302351988268
  807. Etanche Bluetooth SmartWatch Montre Intelligent SIM Sport T%C3%A9l%C3%A9phone 651405203325
  808. Short de bain RIP CURL blanc taille L 113507568943
  809. Elvis Presley Love Songs UK vinyl LP album 273610363349
  810. 20Pcs Metallic Gold AB2X Quality Czech Crystal Faceted 163450542173
  811. 8GB Kit 2x4GB M%C3%B3dulos RAM Memoria Dell Precision 113225813237
  812. DVD 10 jaquettes BE 152932614389
  813. Bague argent 925 000 rhodi%C3%A9 arabesques pav%C3%A9 en pierres 273627176010
  814. DPAM Pyjama velours bleu 24 mois Tr%C3%A8s 332957765408
  815. Case 586 E Gabelstapler von Conrad 2993 135 183587230464
  816. 1 Bougie LPG 2 NGK OPEL KADETT E Break 152219500672
  817. 72 cpa camp dauvours vue 332606238638
  818. HONDA HR V 16i 4WD 98 06 BOSCH Platinum Ir LPG GAS 183453789381
  819. warner home video gotham saisons 1 et 391803896567
  820. Intermotor Rear Left ABS Wheel Speed Sensor 60334 173574515325
  821. HIGH QUALITY 6 Litre Deep Stainless Steel Stock 130384848338
  822. DEFI CORDE DE RECHANGE COSMOS 30 m 2bb 362503020679
  823. Hummel Slimmer Stadil Duo Low Top Sneaker Handball 381542479636
  824. 2 Stickers Plaque Auto Immatriculation Departement 44 Region 372483316820
  825. Doudou Disney Nicotoy Marie Chat Des Aristochats Plat 253964462373
  826. 2 L min Solar Powered USB Charging Oxygenator Water 671266545363
  827. Lot De Plats En Inox 153317459823
  828. VW Passat 18 TURBOSI Estate 07 11 BOSCH Twin 153194894686
  829. Campus by Marc O%E2%80%99Polo %E2%80%A2Damen %E2%80%A2M%C3%A4dchen%E2%80%A2Blusen Kleid %E2%80%A2Armee 153288433351
  830. 5 paires de bas vintage nylon armagnac 382698636863
  831. Microsoft Xbox One S Minecraft Limited Edition Bundle 273615430662
  832. COMLINE et Barre Stabilisatrice avant Lien CSL7159 163436973139
  833. Bora Bora Booney II Sun Sportswear Hat with 391696301475
  834. 17 La Rochelle Aquarium Tortue M%C3%A9daille Monnaie De 371423997423
  835. Baten kaitos NINTENDO GAME CUBE 264105693733
  836. SPIN DOCTORS POCKET FULL OF KRYPTONITE Album 332907668331
  837. Jeu Super Nintendo World League Basketball 283315501496
  838. VESTE GILET GRAIN DE 254013037526
  839. Men of Country 2016 Various Artists CD 142988392313
  840. geeetech A10M modernis%C3%A9 desktop imprimante 3d avec d%C3%A9tecteur 323447576536
  841. Enfants Boxe Ensemble 3ft Sac de Frappe Gants 401656653618
  842. Ancien petit miroir Napol%C3%A9on 3 joli cadre en 251534520230
  843. 100 Pcs M4x9mmx1mm Rondelle plate plastique noir bague 352130021290
  844. CON2449 Chargeur LIEBHERR L566 sur Pneus 173637509557
  845. les faucons de la nuit
  846. R%C3%A9troviseur gauche occasion CITROEN PICASSO ROUGE LUCIFER NACRE 112396553961
  847. Vis Nylon tete cylindrique plate fendue M5x40mm lot 172989053276
  848. Doseur De Bar Bacardi Neuf No Ricard 192772289470
  849. Champion de Sport Femmes Sweat Capuche Fermeture %C3%89clair 233024871807
  850. Lightech Protection Levier Embrayege Alu 148 Bleu Kawasaki 183144868733
  851. Balai dessuie glace pour Toyota Corolla 18 15 CHAMPION 223166887867
  852. Kaufmann Jonas LOpera New CD 362510684044
  853. casque bluetooth avec micro sans fil antibruit %C3%89couteurs 132869867740
  854. Kit grip de r%C3%A9servoir RG RACING translucide 4 173651834671
  855. CELEBRITES PERSONALITIES Lot denviron 50 timbres 271586137421
  856. 07Ho2807 Plaquettes De Frein Avant Brembo Honda Vfr 232828654410
  857. Carte Pokemon Malamandre Gx Pv 200 132 147 372535665804
  858. Pet Remedy All In One Calming Kit 153300470400
  859. HOMME Sport Maillot de Bain %C3%89t%C3%A9 Plage Cordon 123044065905
  860. Femmes V%C3%A9ritable Daim Mocassins Cuir Pantoufles 601295027087
  861. E Neurdein Comtesse de Grignan d039apr%C3%A8s un dessin 390623463729
  862. Smart iptv abonnement 12 mois full hdhdsd 312356617285
  863. Digital Studio Fisher Price 132901858394
  864. horloge foret noire de couleur rouge tr%C3%A8s bon 153289408338
  865. For iPhone 8 Plus Tough Armour Case Hard 202284891578
  866. ensemble bustier jupe DES FILLES A 113475656603
  867. Ultra Capot de coque arri%C3%A8re dur Case Pour 432148811764
  868. Mercedes C Class Cl203 2002 Rhd Rear Left 253661680664
  869. Lecteur carte vital carte%C2%A0 bancaire tpe Ingenico 264109188347
  870. PS3 TOM CLANCYS GHOST RECON FUTURE SOLDIER 391980659479
  871. PORTE CL%C3%89S TURBO CHARGER TURBOCOMPRESSEUR CHROME Alfa Romeo Mito 273421260943
  872. Der kleine Landurlaub Linklater Eric 292862670288
  873. VW Golf sous LOnglet Carnet Manuel Mode D 132817834154
  874. 6robe bb 6mois 183603783430
  875. Revue Technique Automobile Renault Fuego 283310036499
  876. P21w 382 343 Ba15s 1156 44 Super Led 132673699759
  877. Rosalia El Mal Querer Plv 30 372543270005
  878. Collier en cuir avec personnalis%C3%A9 20mm circulaire Argent 601466177057
  879. Affiche cin%C3%A9ma Harry Potter %C3%A0 l%E2%80%99%C3%A9cole 163394706636
  880. EBC PLAQUETTES DE FREIN AVANT YellowStuff pour Renault 362276065880
  881. Brpads 1680 Kit Pastiglie Freno Brembo Hm Cre X 232829905052
  882. Joint detancheite culasse S203 C 200 CDI 63358127 282863358127
  883. vidaXL Table de Bistro Style Vintage Ronde M%C3%A9tal 143068055445
  884. 14 cpsm LISIEUX La basilique 382426778209
  885. 454922 Monnaie France Hercule 5 Francs 1873ParisSPLArgentKM 8201 142856217288
  886. Amazing Spider Man 282 NEAR MINT 98 382674980507
  887. 5V 2400mA 10A Murale Chargeur USB Adaptateur pour Chambre 352204760170
  888. 50 Android 60 4GB 32GB Quad Core 273618918250
  889. Vintage Dinky 128 Mercedes Benz 600 Pullman Limousine 153316684814
  890. Bague Masculine Anneau Homme Acier Inoxydable Tresse Tribal 123100218026
  891. Tablette Enfant YOKID Educative Android 60 Ecran 7 223274327343
  892. Rouge Cerf Volant Musical Mobile Lit DEnfant Carrousel Berceuse 223228678172
  893. DVD ZONE 2 TRANSFORMERS 3 LA FACE CACHEE 401498782099
  894. jeux ps4 neuf sous blister 401663187498
  895. 6 VERRES A VIN BLANC CRISTAL BACCARAT COTES 372549988369
  896. camion grue dinky toys 183603476912
  897. Texas Texas Greatest Hits CD NEUF 183524077365
  898. Everest 500 Retransfer Ribbon Rimage 192742115083
  899. Nockenwellensensor Sensor Nockenwelle BOSCH 0 232 103 122 252505654578
  900. AMD ATI Radeon Graphics Sticker 7x St%C3%BCck pcs 221778505150
  901. Relais d%C3%A9marreur Yamaha 113495785461
  902. Carte Pokemon Mouscoto Gx 57 111 Sl4 113448836299
  903. Thomas Compressor or Vacuum Pump 415CDC30 24F 24VDC 162859804002
  904. Reloj Ruso Vostok Komandirskie Junior Sovietico Russian 183575733369
  905. 10 20 50Pcs Puissant Aimants N%C3%A9odyme Magnet Forte Super Ronds 172223760895
  906. Calling All My Deoms Live At Winnipeg 201699568249
  907. Playmobil Western Fort 4 X Palissade 3419 173641871380
  908. Vitre arriere cache batterie Pour Samsung Galaxy A5 282493955814
  909. dvd Garfield 2 323584714551
  910. Fil suppl%C3%A9mentaire pour cl%C3%B4ture anti fugue Mon Jardin 322467973108
  911. Carter dhuile CITROEN SAXO 14 VTS 282856435141
  912. Stevie Ray Vaughan Original Album Classics 181097577525
  913. Maquette en bois chopper moto NEUF Ugears 283292542773
  914. Miniature HUGO BOSS EAU DE TOILETTE 5ML 254040827098
  915. Seat Ibiza Sportcoupe MK5 12 14 16 20 372492793149
  916. BMW E93 3 Series Cab 05on Powerflex Rear 120903486332
  917. Jama%C3%AFque 2013 No 1190 1193 Fleurs 283190799367
  918. Poup%C3%A9e Russe 10 pi%C3%A8ces Fraise des bois Poup%C3%A9e 401274813534
  919. Kycoo Le Destructeur De Fantomes Yu Gi Oh 141663792803
  920. Laptop Charger For HP Pavilion 15 e085ee 195V 65W 122618853449
  921. Lcd Touch Screen for Samsung Galaxy j5 pro 453103245754
  922. Fotoconic 3%C2%A0Rouleau motoris%C3%A9 %C3%A9lectrique Murale Support de Plafond 332987149228
  923. STELLA McCARTNEY ROBE BUSTIER CORSET SILK DRESS SOIE 401274389879
  924. Interrupteur M%C3%A9canique Seat Inca 6K9 14 16V 55Kw 132521335467
  925. LOTS Film Vitre Protection d%C3%A9cran en 332134818877
  926. CR%C3%88ME SOLAIRE ANTI %C3%82GE VISAGE CORPS PLANTERS SPF30 232975868958
  927. Brand New Vintage The London We Love Ladies 352517166200
  928. Revoltech Amazing Yamaguchi Number 10 Psylocke Action Figure 202545382073
  929. 2 EURO COMMEMORATIVE CIRC ALLEMAGNE 173661698641
  930. ROULEAU BANDE CHROME AUTOCOLLANTE 8 METRES 9mm Suzuki 152682067084
  931. Genuine Pagid Front Rear Brake Kit Brake Discs 232526478564
  932. Chypre Piece 2 Euro Commemorative 2015 30Eme Anniversaire 372550584925
  933. Pompe de direction BMW SERIE 3 E46 316i 121506524918
  934. la couleur du mensonge
  935. une piece or 20F 1914 254040201411
  936. MTS Filtre %C3%A0 particules FAP Pour CITROEN 222051129461
  937. Outdoor New Mens Winter Jacket Fur Collar Thicken 532497236952
  938. Hendrixjimi People Hell Angels Us Import Cd New 113360820790
  939. technofix city traffic ref313 de 1966boite3 voitures okjoustrabillerarnold 163447439718
  940. McFarlane TOPS TITANFALL 2 BLISK 18 CM ACTION 323515507463
  941. HFA1921 HIFLO Filtro Aria per Honda GL HP 142829537176
  942. Oreiller Coussin auto massant nuque %C3%A9paules cou chauffant 372553309851
  943. Grillage galvanis%C3%A9 %C3%A0 mailles hexagonales 075mm 50cm x 263688405156
  944. Jeu Roulement de Colonne de Direction All Balls 272967906487
  945. Racefx Course Motocross Mx V%C3%A9lo Disque de Frein 362474300735
  946. Chicago Fire Saison 2 NEUF 252570405964
  947. Remington aqualisse extreme Wet 2 straight comme neuf 352554641224
  948. Dark Grey Cotton Smock Dress Comptoir Des Cotonniers 173561436602
  949. Bored to death saison 1 %C3%A0 2 DVD 263018393168
  950. Pasta Lavamani Barattolo Da Lt Kg 1 Detergente 121824147875
  951. Actvision Destiny 2 %C3%A9dition collector NEUF 311955039370
  952. SONDA LAMBDA VAUXHALL ASTRA Mk V Estate 253529723324
  953. VW T4 19 TD 24 D 25 TDi 263992693821
  954. BILSTEIN B4 Amortisseur pour Renault Megane II Coup%C3%A9 cabriolet 142920426090
  955. ancienne figurine porcelaine bavaria susi kunst kronach germany 173242537978
  956. Monzani MZEP 1170L Bb Bariton Neusilber Mundrohr 192602814300
  957. Borsa Da Tunnel Givi Per Scooter Con Tasche 282245083946
  958. Pochette pour carburateur Z%C3%A9nith 32IF2 V10511 sur 302868208805
  959. analyse approfondie des Chin Na du Shaolin par 132843001600
  960. Nasse %C3%A0 rat multiprise forme rectangulaire Masy Grillage 283092248756
  961. Blowout Sony Ps2 Playstation 2 Pal 132561132246
  962. Beau cadre en bois et stucs dor%C3%A9s fin 163285284962
  963. Alloy Wheels 15 Calibre Motion Grey For Dodge 392135099244
  964. 2 Bridgestone Turanza ER30 235 55 R17 99Y 235 391849104842
  965. Headlight H4 Pro HID Kit 4300k White 55W 173328599376
  966. Bras Liaison D Suspension TRISCAN AUDI A4 Avant 151167381166
  967. 2 Euros Commemorative Chypre 2017 Paphos Neuve Sous Capsule 163455787306
  968. Charles Bronson 8x10 Photo 20x25 cm approx 192609699395
  969. 6 verres a vin blanc porto cristal darques modele 173715007998
  970. Verres de couleur cristal qualit%C3%A9 Saint Louis 223270164950
  971. Babyliss c1100e Curl Secret Ionic Fer %C3%A0 Friser%C2%A0 132890634474
  972. Plaquettes de freins avant ATE pour Citro%C3%ABn Jumper 112638519117
  973. Lot De 4 Hauts L xl 153276576661
  974. Motor %C3%96l 5L MANNOL 5W 30 Combi LL MANN FILTER Citro%C3%ABn C3 113400393139
  975. 25L Bondex Impr%C3%A4gnierung Plus Holzschutz Grundierung Holzgrundierung 192254547751
  976. FERODO 4 PASTIGLIE FRENO ANTERIORE per KYMCO XCITING 142833081738
  977. Jama%C3%AFque Jamaica Lots Timbres Blocs 254039700449
  978. Compresseur Clim Skoda Octavia Ii 1Z3 20 Tdi 123120221186
  979. Ceinture Homme Pu Cuir Double Croute De Cuir 142227717324
  980. 8454 BATTERIA BOSCH YB9 B 12V 9AH Piaggio 132479421531
  981. BODYSTYLE Hinterradabdeckung YAMAHA MT 07 Motocage RM17 RM18 332706445202
  982. GONN Time Travel 50 Years 2x LP NEW 391635639062
  983. PEUGEOT 306 3 5 portes 19 D 68ch POULIE 401517910456
  984. D%C3%A9marreur 08 Kw Fiat Brava 12 Cinquecento Seicento 142400920752
  985. TPLink Tp link carte WiFi PCI Express 11n 300Mbps 232640174474
  986. Film Kodak Kodacolor X Vintage Film Sealed New Neuf 132891341756
  987. ORIGINAL Ford Inspektionskit Filterset Galaxy Mondeo IV S Max 171564156712
  988. Plv 25X14 Promo Juliette Greco chante Brel 223305711362
  989. ASSASINS CREED le guide essentiel HACHETTE %C3%89DITIONS 113504367791
  990. Who I Am US Import von Gary 123497733431
  991. 5m Right Angle Figure 8 Fig of 8 142579527963
  992. Plaquettes De Frein Arri%C3%A8re Brembo Carbone Ceramic Bmw 312305882134
  993. Chaussures Homme lacets Noir Ann%C3%A9es 2000 152892432192
  994. Flywheel Two mass Flywheel SACHS 2294 001 399 362391423128
  995. Komar Papier Peint Feather D%C3%A9coration Murale Art D%C3%A9co 143074067850
  996. Skip Hop Zoo Stack and Pour Buckets 302321032122
  997. un debut prometteur
  998. S%C3%A9rie 8 pi%C3%A8ces 1 Cent %C3%A0 2 euro 362466532359
  999. Rimage Everest I II III Retransfer Roll 171857121836
  1000. Kale Plaquette de Frein Set Essieu avant Sabots 323527506381
  1001. 45 Tours STEVIE WONDER Do I do 131684279896
  1002. Bilstein B6 Front Right Shock Absorber for Saab 232158987057
  1003. Fits Kia Picanto 10 Genuine OE Quality Apec 362354616622
  1004. Belle poign%C3%A9e de sabre Tulwar Talwar indien en 352539098148
  1005. Rodin Quartett String Quartets Op 95 132 CD 302970111566
  1006. Philips Avent Robot cuiseur mixeur multifonction pour b%C3%A9b%C3%A9 EasyPappa 372543986044
  1007. Art nouveau Necessaire de toilette en opaline signeSchneider 183613831121
  1008. Rallonge alimentation molex male vers molex femelle 352407388259
  1009. LEVA FRIZIONE SINISTRA KYMCO Venox 250 2004 2005 371511328500
  1010. Lot de 67 sucres publicitaires emball%C3%A9s chat chien 372548200658
  1011. Pompe %C3%A0 carburant pour Audi Quattro 22 Turbo 223216635823
  1012. Batteur %C3%A9lectrique 150 watts Dunlop 232996206724
  1013. JT 520x1r2 Pignon cha%C3%AEne Yamaha WR400 F L 292107123997
  1014. Pink Floyd The Final Cut NEW 12 311761261956
  1015. Innere Medizin II de Linus Geisler Livre 123503125730
  1016. vidaXL B%C3%AAche et tari%C3%A8re manuelle 120mm Avec Rallonge 401676436673
  1017. Brand New Genuine TRW Brake Caliper BHN276E Rear 362387207368
  1018. 2 Cache Phare Oscar 264066724067
  1019. Encres compatibles Brother MFC J650DW cartouches LC123 372171727206
  1020. 6 assiettes plates en fa%C3%AFence de Lun%C3%A9ville mod%C3%A8le 192722731815
  1021. Fifa 19 PS4 163458849233
  1022. 4x racepro Violet COURSE perc%C3%A9 Boulon %C3%A0 %C3%A9trier 192315188983
  1023. les cha%C3%AEnes de distribution Cl%C3%A9 QMB a139 ZONGSHEN Leau 263202499436
  1024. Demarreur RENAULT SCENIC II PHASE 1 Diesel 291950690497
  1025. Officiel Shimmer et Brillance Zahramay Coussin R%C3%A9versible 40cm 292755159192
  1026. TAGLIANDO OLIO MOTUL 5000 10W 40 FILTRO CINGHIA per 132658883647
  1027. Spirograph Lansay Set De Cr%C3%A9ation 31007 Neuf 163460928258
  1028. Pompe %C3%A0 essence silencieuse pour PEUGEOT 504 311858479680
  1029. Lego Star Wars Minifig Clone Trooper 601879298175
  1030. PetSafe PIG19 10763 Collier Suppl%C3%A9mentaire Cl%C3%B4ture Super Radio 233068922585
  1031. 6 Professional Hair Cutting Scissors Cat Pet Dog 292639685794
  1032. Lot 70 environ 33t Musette Divers VI07 283321397227
  1033. Brand New Replacement TOSHIBA PSKDLE 09Q009GR 156 Screen Glossy 192141345832
  1034. Collection de d%C3%A9s %C3%A0 coudre dont en bronze 163449422895
  1035. Plaque de boite aux lettres 1 ligne 10x25 581651118251
  1036. 6X Iridium Tip Spark Plugs For Jeep Cherokee 222986895429
  1037. Yamaha XT 125 X Geweih Verkleidungshalter 2 Bj05 401024549138
  1038. lot de 5 blu ray 323623565676
  1039. b girl
  1040. Cn Oblique Bangs Court Boucl%C3%A9 Perruque de 123366113803
  1041. simca chambord 1958 132882090731
  1042. 2X White 4 1 Cree Led Side Light W5W 253646477471
  1043. Vanne isolatrice relevage 2 voies pour Massey Ferguson 332338715822
  1044. D%C3%A9pt 13 Marseille 22 Rue Mazagran 113340336288
  1045. Rare Mouvement Automatic De Montre Longines 6332 392112557961
  1046. Jamaique Timbre Fiscal N%C2%B0 3 Avec Obliteration 173678782807
  1047. Lightech Repose Pieds Commande Origine Bleu Honda Cbr 183144863379
  1048. Externe Power Bank 50000mAh Batterie Double USB Chargeur 323360287966
  1049. antboy 3 le combat final
  1050. Piovra La Stagione 09 2 Dvd Serie 183503501909
  1051. Pi%C3%A8ge pour nuisible Lucifer Pi%C3%A8ge forg%C3%A9 %C3%A0 282650651500
  1052. Watch dogs ps4 223295621104
  1053. kevin hart what now heey
  1054. CAT Caterpillar R D 143070169980
  1055. Maillot De Bain Taille M 273633629079
  1056. des vents contraires
  1057. %C3%89cran vitre Tactile LCD assembl%C3%A9 Pour Samsung Galaxy 201986524102
  1058. Ladies Size Small Full Length Suede Chaps Green 132886370182
  1059. LA ROCHE POSAY HYALU B5 Soin Anti Rides 223238331641
  1060. nappe de vintage 183501065071
  1061. 100PCS 0603 Yellow Light SMD SMT LED 173563668536
  1062. MAXX Luxe Parc Enclos pour Chiens 382694859151
  1063. AFFICHE CINEMA Deux Flics A Chicago 1986 323513970616
  1064. Fer %C3%A0 friser interchangeable en c%C3%A9ramique Curler boucleur 142808089894
  1065. Filtro Olio Lancia Dedra 835 19 Tds 835Ee 173203198095
  1066. Pompe de Gazoil Toyota Land Cruiser 24 i 111807124361
  1067. Victron Energy Phoenix Onduleur 12V 400W 12 500 Schuko 253192560698
  1068. mange prie aime
  1069. Polyethylenschlauch Pneumatik PE Schlauch Pneumatikschlauch a Gr%C3%B6%C3%9Fen 111358929954
  1070. Johnny Hallyday Album De Lamour Cd 372164466285
  1071. Colliers de serrage plastique incolore ou noir 5 461560195320
  1072. Latigo de Burt Kennedy DVD %C3%A9tat 123571082636
  1073. Maquette dune remorque groupeuse de bottes au 1 32e 253954301268
  1074. The Platinum Collection de NelsonWillie CD 123549802973
  1075. Luftfilter KRAFT AUTOMOTIVE 1714605 232978634232
  1076. Rotation Etui Housse Coque pour Huawei MediaPad T5 382681142433
  1077. Nappe N%C2%B026 ancienne en lin 178 323213771520
  1078. neuf avec %C3%A9tiquette b%C3%A9b fille velours doux Tout en un 650884788370
  1079. Neuf Arri%C3%A8re Rigide Damas %C3%89tui COQUE pour Apple 584201287494
  1080. Women Bone Frame Skeleton Jumpsuit Halloween Printed Bodysuit 323439195647
  1081. KAMOKA Lagerung Lenker f%C3%BCr Radaufh%C3%A4ngung 8800152 232800993666
  1082. Cremaillere assistee PEUGEOT 307 PHASE 2 Diesel 252960327800
  1083. Citroen C4 Picasso 05 10 Ground Zero Speaker 165mm Front 401587006057
  1084. Mug Tasse Wonder Woman Dc 273186647287
  1085. Fleur Double %C3%89toile Rond Serti Diamant Femme Bague 273449902121
  1086. Dreamcast Quake III Arena Game 142645099960
  1087. simca chambord 1958 132902042130
  1088. Pompe a essence 23221 74110 223235522054
  1089. PASTIGLIE POSTERIORI YAMAHA VP X City 250 cc 152332777931
  1090. JOLI VASE en OPALINE Blanche %C3%A0 d%C3%A9cor de 183583833393
  1091. Pin Button Badge %C3%9838mm Drapeau Flag Echarpe Maillot 360814519093
  1092. SuperPro Poly 26mm Front Sway Bar Mount To 332463944578
  1093. vidaXL Tapis Moderne Design Traditionnel 140x200 cm Beige Gris 143070583549
  1094. Lampe frontale LED SENSER IH6 NEUVE 264081045142
  1095. Alloy Wheels Tyres 18 DRC DRM For 312253765195
  1096. Sus Primeras Grabaciones Solista Miguel Montero 2005 161951721927
  1097. The Lord Of The Rings The Two Towers 292845550920
  1098. ZEELAND Province Drapeau Pays Bas 100mm Sticker Autocollant 322927060140
  1099. Mens Luxury Soft Quality Leather Wallet Credit Card 311473825665
  1100. Mens Vintage Wrangler Blue Blanket Lined Denim Trucker 192766487963
  1101. fm10 t shirt uomo NCIS Naval Criminal Investigative serie 410126285154
  1102. Collier De Soufflet De Cardan La Graisse 362513115792
  1103. ANCIENT MEDIEVAL IRON CROSSBOW BOLT arrowhead 401657869119
  1104. A Chiarolla Baghera N%C2%B0 22 Lhomme Au Crane 300663938063
  1105. Ancienne Broderie Au Ruban Rose Art Deco 1925 382697345799
  1106. Ensemble 3 pi%C3%A8ces CADET ROUSSELLE 6 mois b%C3%A9b%C3%A9 173613783337
  1107. Kappa Givi Valigia Kgr46 Garda Monokey Per 183024501319
  1108. femme 2 pi%C3%A8ces moulant 2 pi%C3%A8ces haut court 183224872823
  1109. METALCAUCHO Support moteur Droite Avant 00997 pour Renault 401345922768
  1110. BOSCH Flexible de frein Avant Pour CITROEN SAXO 401628637096
  1111. 12 petites cuill%C3%A8res anciennes INDOCHINE Argent massif 322996048372
  1112. My Nrj Hit Music Only 2005 de 123565188336
  1113. Orologio SEIKO 5 ref SNK617K1 Uomo acciaio automatico 273310612998
  1114. Baccarat Saint Louis 6 Verres A Vin Cristal 173708079356
  1115. Pompe a essence 4 Runner Camry 223235515313
  1116. Eau de parfum Cartier Baiser Vole 100ml EDP 163080856486
  1117. GameBoy Color MTV Sports TJ Lavin Ultimate BMX 202520220226
  1118. Le tr%C3%B4ne de fer George RR Martin Game 123360743594
  1119. 4 x Somfy KEYGO 4 RTS t%C3%A9l%C3%A9commande 151057656253
  1120. Endless love Tome 1 de Tan Cecilia 123557349460
  1121. 1 FAG 713610030 Set palier roue Transmission automatique 123509297864
  1122. disque dur western digital 320 go 25 sata 232988477078
  1123. Ancienne Coupe %C3%A0 Fruits Compotier sur Pied en Verre 173564114768
  1124. Buffet Commode Dressoir Cr%C3%A9dence Bari en Noir 410296747306
  1125. Pour Nissan 350Z G35 2002 2004 35L V6 VQ35DE 192680422532
  1126. Action Figure Funko Domo Pop Vinyl Ghostbusters Stay 153076652729
  1127. Carter de filtre %C3%A0 VW A4 B6 Superb 223139601960
  1128. Gros Vase Daum France 233010931386
  1129. Vestito Donna Made In Italy Patrizia Pepe 254028620794
  1130. vidaXL Chemise pour hommes taille XXL Blanc Chemise 143073616553
  1131. Tablette PDA Tactile 9 pouces Android 4 Wifi SD7058 223295059798
  1132. LOT DE MINIATURES NOREV CLUB TOTAL neuves en 113488545957
  1133. Photographies Anciennes Indiens Ensemble De 38 232990778266
  1134. Legrand 006564 Disjoncteur magn%C3%A9to therm DX 6000 283293973597
  1135. ROLLING STONES Dirty Work PLV 283316456513
  1136. Mercedes G Class W463 300 GE 2 Terminal Febi 302004950148
  1137. Type V fluorescence reflechissant gilet de securite%EF%BC%88Jaune%EF%BC%89 P4N1 113397196809
  1138. Official T Shirt MEGADETH Black Countdown to Extinction 462098067834
  1139. JEU WII AVEC CEINTURE ZUMBA FITNESS JOIN 273517214545
  1140. Pastiglie Freno Posteriore Sinter Ebc Fa165Hh Triumph Tiger 141963328840
  1141. MG16 Rouge 362515869129
  1142. vintage dinky toys 283321645822
  1143. Assiette en fa%C3%AFence type Nevers type R%C3%A9volution fran%C3%A7aise 183605592412
  1144. pompe a essence 23221 28020 23221 112802434804
  1145. Plaquettes De Frein Arri%C3%A8re Organique Trofeo Suzuki Gsf 264050234029
  1146. comme un roman
  1147. Binari LEGO per treno city 7499 7898 233067632025
  1148. Cremaillere assistee PEUGEOT 207 PHASE 1 Essence 182644784782
  1149. FILTRE %C3%80%C3%82%C2%A0GAZOIL FIAT BRAVO II 19 D Multijet 132530401663
  1150. Ancienne assiette metal argente pour enfant avec cuillere 172896432847
  1151. Replacement Silicone Watch Wristband Strap Bracelet Fr Xiaomi 452922598792
  1152. Collana MORELLATO BLACK AND WHITE SCU01 Acciaio Agata 141633237777
  1153. MERRELL Vapor Glove 3 J77657 Barefoot de Course 472192859055
  1154. Pro Office Suite 2018 Compatible with Microsoft 282774244141
  1155. MANN FILTER %C3%96lfilter HU 720 3 x f%C3%BCr BMW 5er 382699905717
  1156. 2 x souriciere LUCIFERles VRAIES 282604382024
  1157. Les Aventures De Pif Le Chien Tome 5 171964176632
  1158. Pc Toshiba 254036310705
  1159. Wellendichtring f%C3%BCr Kurbelwelle Simmering Kurbelwellensimmering Breite mm 282593718054
  1160. 10880 BATTERIA BOSCH YB4L B 12V 4AH Derbi 401481489444
  1161. Adjustable Charging Stand for NINTENDO Switch 382639741590
  1162. 100Pcs Boutons Tubulaires Rivets Cristal Artisanat Ceinture Accessoire 492664769185
  1163. Robe Bebe Blanche Sans Manche Avec Bretelles Plastron 173708531833
  1164. 20 22mm Silver Adjustable Folding Stainless Steel Link Watch 382609640874
  1165. Mercedes B Class W245 2005 2011 Front Brake Repair Kit 261469612121
  1166. 50x Clip Noir Garde fil assortiment Cadre Cl%C3%B4ture 392201797224
  1167. non Disponibile 371516138654
  1168. BOSCH 1 457 429 610 %C3%96lfilter f%C3%BCr MERCEDES BENZ 183521397838
  1169. E27E14 vis en c%C3%A9ramique base ronde ampoule LED 572298163763
  1170. Interrupteur Feu de freins AIC SKODA FABIA A 151273551714
  1171. PCI VG 5 PU Vorstrich 5 kg Polyurethan Vorstrich f%C3%BCr 323487700047
  1172. Bleu Abstrait Valentino Cravate en Soie 91cm Large 302995579805
  1173. Der Teppichh%C3%A4ndler 4 CDs de Meg Mullins 123499230008
  1174. 4 Pastiglie Freno Anteriori Brembo Carbon Ceramic 07Ya1107 141968747261
  1175. %E2%99%A6Yu Gi Oh%E2%99%A6 Clerc Galactique Galaxy Cleric Photon 521994715518
  1176. I Adapt%C3%A9 %C3%A0 Toyota Verso Voiture HOUSSES 183483637694
  1177. MONTMARTRE Ren%C3%A9 CLAIR Obscur SOUS LES TOITS DE 163458338844
  1178. Pompe a essence LEXUS LX 470 47 i 223235522995
  1179. les vaches huile fin 19e pr%C3%A9impressionniste non sign%C3%A9e 153317031594
  1180. LE CREUSET s%C3%A9rie 5 casseroles et %C3%A9tag%C3%A8re bois 382654775935
  1181. Jeu de disques de freins arri%C3%A8re VALEO Seat 273074241998
  1182. recepteur dembrayage YAMAHA 1200 FJ ABS 3CX 153270805992
  1183. %E2%98%86Bracelet jonc rigide en plaqu%C3%A9 or et pierres 292814067887
  1184. Doudoune de ski Femme Marque Wedze Taille 44 143072545483
  1185. Marrube blanc Marrubium vulgare 50 grammes 151086066633
  1186. MG MGF %C3%A0 02 Powerflex Black Series bras 222740523868
  1187. PurcellVinyl LP 1st PressMusic For The Chapel Royal Argo ZRG 311433521790
  1188. Plaquette de frein Carbone Lorraine Moto TRIUMPH 800 202508700891
  1189. LC nylon animaux chiot maille douce Harnais pour 423539607198
  1190. Telescopic Extendable Adjustable Handle Garden Rake 605mm %E2%80%93 123485624563
  1191. Mercedes A Class W169 H7 H7 501 100w Super 302704177571
  1192. Multifonction Pyrogravure Machine Gourde Bois Pyrogravure Artisanat Trousse 264045972142
  1193. SENSOR DE PRESION BMW X1 E84 xDrive 20 253701523502
  1194. Set Porte Bagages Givi Sr1161 Pour Crf1000L Africa Twin 253980935496
  1195. Various Artists Ghana Rhythms Of The People CD 112425021325
  1196. Passage de roue Ermax Suzuki GSF 600 BANDIT 350742701995
  1197. Pro Mini 2en1 Fer %C3%A0 Friser Fer 302140967477
  1198. Sound music control 18W RGB Led stage Effect 253917122494
  1199. Jill Detroit Pompeii The Musical CD RP US IMPORT CD 113318006189
  1200. De Buyer Casserole Inox Primappety 12 %C3%A0 163419953882
  1201. 2 Channel USB Battery Dual Charger Micro USB 282671421578
  1202. Official Pantera 101 Proof T Shirt Snake Far Beyond 424082663652
  1203. CITEL VIDEO Zorro Volume 4 Un secret 311886079544
  1204. Chemise %C3%A0 manches longues bleu blanc motif ray%C3%A9 style 173710691687
  1205. 21 articles pour la cuisine Cocotteassiettesplateaucouverclespani%C3%A8res 202548576760
  1206. Premium Pencil Type Ignition Coil for Renault Megane 323060753960
  1207. 2x Hochleistungs AKKU 40V 4000mAh Li Ion f%C3%BCr Greenworks 332027087808
  1208. Hankook 80Ah Batterie de Bateau Marin DC24MF 272182326167
  1209. HILFIGER DENIM Chemise en flanelle noir rouge fonc%C3%A9 motif 173702372715
  1210. Pompe a essence 23221 46010 23221 323555514964
  1211. LEGO 71001 N%C2%B015 ARTISAN PEINTRE BATIMENT ROULEAU 153318178403
  1212. Ancien Rond De Serviette A Pied 302746208236
  1213. Shirley Bassey Where Do I Begin Love 183497464171
  1214. Gb 2018 Game Of Thrones Films Sci Fi 173073002156
  1215. FUNKO POP Wonder Woman CHASE 167 DC 283321699233
  1216. appareil de mesure avec pince amp%C3%A8rem%C3%A9trique CHAUVIN ARNOUX 254026774774
  1217. EBC BSD Rear Brake Discs 272mm for Audi 292444102350
  1218. JANTES ROUES MSW 49 9x19 ET 44 MERCEDES 332654443959
  1219. GUIRLANDE 12 m%C3%A8tres 20 DRAPEAUX PIRATE T%C3%8ATE DE 272283818648
  1220. Italie vintage albumen print Tirage albumin%C3%A9 371656032332
  1221. Protections de plancher de pied de chaise de 192746584006
  1222. CALCIATORI 1987 88 87 1988 n 495 LUCCHESE SQUADRA 160896860091
  1223. ZERO Chemise %C3%A0 manches longues bleu azur style 173697799220
  1224. CHYPRE Coffret BU 2008 Officiel 362519145964
  1225. pour Mazda BT 50 2WD 4WD 2006 arri%C3%A8re ressort 183290952209
  1226. Dvd bundle 202511503016
  1227. DVD Days Of Our Lives Queen 163290188781
  1228. For Audi A6 Avant Front Lower Right Suspension 161166354278
  1229. H R Entretoises de Roue VA 382546634691
  1230. God of War Collection Remastered HD Volume II 323556025200
  1231. Starter Motor fits BMW 325 F31 20D 2013 332571484098
  1232. COVER Custodia rigida Trasparente sottile Slim BIANCANEVE per 121770721927
  1233. Blic R%C3%A9troviseur Ext%C3%A9rieur 5402 04 1131850P 142692306843
  1234. Bmw X5 E70 Power Steering Pump 678100802 292829755744
  1235. Service %C3%A0 fondue le Creuset en tbe 233063909414
  1236. VW Golf MK3 18 Syncro Exc Wear Sensor 361487962451
  1237. 2 Ampoules Led Vw Golf 3 Polo 382039587713
  1238. Marmite Faitout Avec Son Couvercle En T%C3%B4le %C3%89maill%C3%A9e 132897004323
  1239. POGS T POKE6 002 Lot de 6 Pogs 391525304983
  1240. petit peson ancien balance 192761330719
  1241. SILVER Samsung SSD Activated Stickers 7 vinyl 10 262983430222
  1242. Playstation 2 Video Games Lord of the Rings 113458967674
  1243. PUBLICITE ADVERTISING 116 2006 Tiffany 311740360394
  1244. Monnaie Romaine Constantin Ier Le Grand 322 Centenionalis 223287004326
  1245. JOLI BONNET DE b%C3%A9b%C3%A9 en DENTELLE BLANC CASS%C3%A9 292874932235
  1246. %E2%99%A6Yu Gi Oh%E2%99%A6 Aile Noire Pinaki la Lune Ascendante 321698589403
  1247. Adidas Spain International Mens Home Football Soccer Shirt 312185639502
  1248. HYUNDAI GETZ 2 x H4 120 SMD LED 122414876045
  1249. Ecran Complet Tactile LCD Pour Samsung Galaxy J5 553184680665
  1250. 24V Air diesel Heater LCD Chauffe Chauffage 5 233071813141
  1251. Three Men in a Boat de Jerome Jerome 123560591172
  1252. Kit Main courante Rambarde Support mural 60cm Blanc 192657502556
  1253. 225101453 RMS Plaquettes de frein arri%C3%A8re TM Enduro ANGL 253105282997
  1254. Doudou plat vache rose mongolfiere nuage GIPSY RARE 200467517211
  1255. Dragon Ball Raging Blast Playstation 3 323449782845
  1256. Ancienne Porte Arriere Pour Horloge Ou Pendule Xixeme 132898098374
  1257. Doctor Strange Steelbook BLU RAY NUEVO 332978588467
  1258. CITROEN FIAT PEUGEOT 1994 EGR Valve Exhaust Gas 172671494792
  1259. 2 Cartes de lavage Total Wash 82 euros 264097295509
  1260. 2 Ampoules Led Vw Bora Bax9S H6W 9 252860825323
  1261. 5206Ng Paire Amortisseurs Arri%C3%A8res Peugeot 308 16 80Kw 263929878487
  1262. Vtg 1977 USAF Type N 3B Cold Weather Flight 323584297978
  1263. 4 Autec BALTIC 75x17 ET40 5x1143 f%C3%BCr Dodge 282948945281
  1264. haut femme 132894251123
  1265. MERINO WOOL PURE DUVET QUILT 100 320964549986
  1266. david et goliath
  1267. MAZDA 3 Factory Style REAR ROOF SPOILER WING 322665844083
  1268. Etouffoir Intercepteur carburateur WEBER DRT Renault R9 172249132201
  1269. ancien necessaire de toilette trousse de voyage complete 173027358806
  1270. Vsbc193R 792 Front Rh Brake Caliper New Unit 311925650575
  1271. Chaps Equitation 192758948200
  1272. poissonniere 362512749994
  1273. XS Taille Unique Neuf Esprit Homme Court 113491204133
  1274. GAASTRA Chemise %C3%A0 manches longues rose blanc motif ray%C3%A9 173696240531
  1275. 2 Wheelbarrow InnerTube 350 8 350 8 Wheel Barrow Sack 192365197344
  1276. La Plus belle ville du monde Combo Blu ray 254010159055
  1277. Comline Service Kit Air Oil Fuel Pollen Filter 232910228792
  1278. 142950 Cuerpo blanco unicornio 2u playmobilbody 222615350218
  1279. PFR5 4626BLK Powerflex Rear Diff Rear Bushes BLACK Series 173174483346
  1280. Sunshine Live die 90er Vol2 de Various CD 123565373541
  1281. SENSOR ABS RUEDA HYUNDAI TUCSON 20 CRDi Allrad 252899952530
  1282. lot jeux ps2 173702307785
  1283. Okeya Kiridashi Kogatana Gaufr%C3%A9es Motif Lame Japonais Couteau 192749172747
  1284. Bob et Blop tome 1 La Nuit 123560774048
  1285. 1Paire Boucle doreille Fleurs de Daisy Cristal Brillant 423125264417
  1286. Pavillons que la plupart des nations arborent en 202552010548
  1287. Pins Shell Objet De Collection Essence 163427346784
  1288. TOMMY HILFIGER Blouse chemisier motif ray%C3%A9 style d%C3%A9contract%C3%A9 Dames 173705374943
  1289. Opel Vectra B de 97 2001 limo Tapis 162373707579
  1290. Mode Boucles doreilles Femmes Cristal G%C3%A9om%C3%A9trique Cristal Brillant 442005822276
  1291. Stainless Steel One Hand Pressure Cooker Stockpot Induction 332196427624
  1292. Peugeot 208 2008 Citroen C3 Wing Mirror Indicator 323388769154
  1293. Case IH B414 Kit Durite N%C2%B0 S%C3%A9ries 30925 233075659549
  1294. Ecran Complet Tactile LCD Pour Samsung Galaxy J5 132864333380
  1295. Winning Post SHVC WJ Super Famicom SFC Nintendo JAP 183029254780
  1296. mur palissade fort western playmobil 131841176889
  1297. des a coudre de collection 192773507827
  1298. TRW Bremsschlauch Links Vorne Ford 202053893511
  1299. Condenseur de clim CHEVROLET KALOS Essence R4221140 182946620143
  1300. Dinky Toys Gb coffret rarissime n%C2%B02 PRIVATE AUTOMOBILE 390853262375
  1301. Ecusson bouche patch brod%C3%A9 applique thermocollante iron on 222671320757
  1302. Cookware Casserole Stock Saucepan Pot Set Lid Aluminium 172328908758
  1303. Casio Mens Plaqu%C3%A9 Or R%C3%A9tro Num%C3%A9rique A159WGEA 1EF Montre 222487926928
  1304. Batterie Bateau Hankook 80Ah 12V 4 271938821648
  1305. 2 Ampoules Led Vw Bora C5W Navette 9 382235598821
  1306. Bougie Ngk Br7Es 220817447973
  1307. Traite Des Successions Par Feu Mr 112274793134
  1308. Bredemeijer G016Z Th%C3%A9i%C3%A8re Aladdin Fonte Noir 160 x 312390302913
  1309. Dvd Seda Michael Pitt Keira Knightley Usado Buen 142395181731
  1310. HERPA ALBEDO 401663423131
  1311. Pretty Women Summer Fashion Vintage Boho Long Maxi 202367398514
  1312. Rainforest Rendezvous Music For Relaxation Various Artists CD 132638007518
  1313. 10W LED Rechargeable Portable Projecteur Lampe Blanc Travail 192656340429
  1314. 2x 185 65 R14 185 65 14 1856514 323086040157
  1315. et ta soeur
  1316. 2x Noir Blanc Support de Plaque DImmatriculation Audi A3 401616661701
  1317. Bouillotte Micro Onde Coussin Cervicale Graine De Lin 302411261262
  1318. Reggae for Lovers Vol1 de Various CD 123564205329
  1319. Dunlop 549R150 Pack 3 m%C3%A9diators Flow Standard 132821471520
  1320. Roy Kirkham Animal Mode Chien Grand Petit D%C3%A9jeuner 192765714650
  1321. bullet head 2thq
  1322. le guide des infractions le guide 382638388516
  1323. 5pcs Boutons Coudre V%C3%AAtements Rembourrage Pression en Strass 192555657832
  1324. FILTRO ARIA CITROEN XM Break Y4 21 D12 162934869498
  1325. %E2%98%86Bracelet jonc rigide en plaqu%C3%A9 or et pierres 292795295500
  1326. Distributeur de Bonbons Cacahu%C3%A8tes Regal 1940 Th%C3%A8me 292891924771
  1327. BLOUSE DESHABILL%C3%A9 TUNIQUE PAGODE TU 273605986459
  1328. Bernd Begemann Rezessionbaby Cd Neuf 263753673678
  1329. 40 60 70cm Glissi%C3%A8res de Tiroir %C3%A0 Extension compl%C3%A8te Coulisse 502574831791
  1330. Lightech Front Footpegs Original Rear Sets Gold Honda 173236108148
  1331. Bonnet B%C3%A9b%C3%A9 Fait main 283320015640
  1332. New Lepel Rosey Underwired Balconnet Bra Animal Print 272462046962
  1333. Ein gl%C3%BCckliches Paar 2 Audio CDs de William Somerset 123492667646
  1334. Traverse de pare choc avant occasion 00007414XQ 132870236422
  1335. Kenwood MP3 Bluetooth DAB USB CD Autoradio f%C3%BCr 392080722185
  1336. 2 Ampoules Led Alfa Romeo Gt Bax9S H6W 382039605453
  1337. HOTPOINT ARISTON LAVE VAISSELLE 60 Pose Libre Finition 323626927252
  1338. SuperPro Poly Front Rear Control Lateral 332466310671
  1339. mythica la couronne de fer
  1340. RONDO VENEZIANO MASQUERADE 1989 Baby Records 202540093689
  1341. TRIXIE Enclos m%C3%A9tal verni %C3%9886cm Pour 283302131023
  1342. L Shape DRL LED Daytime Running Lights Lamps 302828233561
  1343. Self Tanning Spray for Quick Tan Medium Dark 6 332690948700
  1344. st vincent
  1345. N%C2%B0 433 Carte Panini Adrenalyn Xl Foot 283312410073
  1346. 5 Carrosses %C3%A0 Drag%C3%A9es ou Confiseries Sacs 112987708304
  1347. 10 Graines Aryrocytisus Battandieri Cytisus Battandieri Marocain Gen%C3%AAt 261816015046
  1348. Mixeur blender %C3%A9lectrique en acier inoxydable 1200W 175 223126984202
  1349. Serie De 5 Casseroles En Cuivre 202540997774
  1350. Hot Steampunk Goth Goggles Glasses Retro Flip Up 323582291332
  1351. Tableau Chat A Realiser En Pate A Modeler 352542463645
  1352. Wall Stickers Tiger animal Relax Cool Hall Bedroom 601864774516
  1353. HELLA Sensor Motor%C3%B6lstand 192285015192
  1354. SEIDENSTICKER Chemise %C3%A0 manches longues motif %C3%A0 carreaux 173682149356
  1355. XGODY 55 4G LTE Android 16GB Quad Core 253374694141
  1356. Termostato De Ambiente Digital Sonder 113235588342
  1357. FILTRO OLIO COMPATIBILE CON NISSAN SUNNY III Hatchback 162935459357
  1358. EGR Valve For VAUXHALL ASTRA G CORSA C 163457166332
  1359. Ancienne Belle Pince %C3%A0 Sucre M%C3%A9tal Argent%C3%A9 Armand 152995362514
  1360. n%C2%B0v322 cardan avg citroen jumper 32729k 362512912952
  1361. Rimage Everest III CD DVD Blu ray Thermal Printer 182902711097
  1362. 2 hostiles
  1363. Cocotte Minute Seb Sensor 233062612248
  1364. Pince Coupe Griffes Taille Ongles Ciseaux Toilettage Chien 162134958511
  1365. Jeu NEUF sous Blister SNES TERRANIGMA Fran%C3%A7ais Super 192710075702
  1366. JEAN LOUIS MURAT Sentiment nouveau CD Maxi 303000790283
  1367. SOLEIL DOCRE Galette de chaise capitonn%C3%A9e Ericka 100 283307744511
  1368. lhomme sans age
  1369. RV Housse cuir portefeuille Nokia 7 Plus amour 113247080486
  1370. pompe a essence Toyota Paseo Hiace RCH 112802433791
  1371. Glitter Powder Poudre Paillette Brillant D%C3%A9coration Ongles Nail 322502030330
  1372. Airfix Un opened plastic kit of a James Bonds 143015425464
  1373. Bouillotte Micro Onde Coussin Zenitude Graine De Lin 292211508122
  1374. %E2%98%85 Carte Pokemon N%C2%B0 38 114 162481003950
  1375. Veritable Terrine Le Creuset 153311415554
  1376. Febi 24642 Capteurvitesse Roue Essieu Arri%C3%A8re Gauche Ou 401524871824
  1377. ENERGY STAR Sticker Aufkleber 221626709846
  1378. lot de timbres oblit%C3%A9r%C3%A9s 1954 254045733178
  1379. Rouge Brillant Velours Housse de Si%C3%A8ge Seat Exeo 292756824792
  1380. i am elizabeth smart
  1381. NFL Football Molleton B%C3%A9b%C3%A9 Animal de Compagnie Lap 441960929287
  1382. JANTES ROUES MAK SARTHE AUDI A6 8x18 5x112 382440698582
  1383. %E2%98%86Bracelet bague MAIN DE FATMA en plaqu%C3%A9 or et 292353687620
  1384. Ford Ranger Ford Explorer Sport Trac Front 300878689934
  1385. Super Stardust Ultra VR PSVR de d3t Ltd 123558089076
  1386. film super 8 kit de r%C3%A9paration 264106826069
  1387. 2017 TSI Paramount Deck V3 Black M 183295287676
  1388. For Peugeot Boxer 230P Bus 20i 94 02 3 372355748980
  1389. Batteria compatibile 5200mAh per ASUS K55VMSX078D NERO COMPUTER 153086813854
  1390. Trasmissione gas PIAGGIO X9 Evolution 250 4 202474321696
  1391. Dosto%C3%AFevsky Lidiot Complet En 2 Volumes 1910 Litterature 292893434785
  1392. Napperon Ancien Xix Fine Batiste Brode 292894477855
  1393. Vw Sharan Ford Galaxy Seat Alhambra Rear Inner 163412211965
  1394. WLT animal shoes WLT Walter van Beirendonck 173714720920
  1395. Kit Dinstallation Vilebrequin Ktm 300 Exc 2005 Hot 362447728480
  1396. 2 Cerchi Camera Daria E Copertone 300 10 Vespa 223165289407
  1397. PRADA Bottes cavali%C3%A8res tout cuir velours beige 40 401527162746
  1398. Digital STC 1000 Termostato de Controlador de Temperatura Multiuso 323578839988
  1399. For Land Rover Freelander 2 Black Genuine Leather 161590664372
  1400. Pontets Telecaster Vintage Compenses Staggered Steel Saddle 122985157092
  1401. 2x Ampoule T10 W5W W3W LED 141752476715
  1402. Kit freins arri%C3%A8repr%C3%A9mont%C3%A9s Renault Clio 14 16V 15 223154313790
  1403. JETTE Blouse %C3%A0 manches longues blanc style d%E2%80%99affaires 173702289493
  1404. EDITH PIAF La Vie En Rose EP 392082231239
  1405. robe 153316957324
  1406. Copper Pan Double Coated Smokeless Non stick 5 Minukate Chef 512617869567
  1407. Etta James Whos Blue US IMPORT CD NEW 113389169741
  1408. Slenderella pour Femmes 100 Jersey de Coton NuisetteChemise 263021291077
  1409. New Genuine MEYLE Engine Mounting 034 024 0028 202139590843
  1410. pompe a essence 23221 20040 23221 28020 112802434216
  1411. Jaula Artesanal Pocito 232827616652
  1412. Ancienne Assiette Faience Les Islettes Signee Hc 352552681161
  1413. THE BEATLES From me to you 183567612613
  1414. Achat Ratgeber Alfa Romeo Ferrari Fiat Maserati 232992447697
  1415. Dimmable light bulbs 30W SES R39 E14 Edison 541417874035
  1416. SCALEXTRIC Digital ARC Pro Slot Car BMW Z4 323627206929
  1417. POT COUVERT OPALINE 19eme 163415530711
  1418. Robe Noire Et Blanche Taille 38 273632945748
  1419. Jeu Plaquettes Frein AV TRISCAN PEUGEOT 206 SW 111267854095
  1420. 2 euros SLOVAQUIE 2012 10 ans de i 264098923026
  1421. Hot Wheels 2011 Nouveau Mod%C3%A8les Honda S2000 Rouge 183478178022
  1422. Soufflet de cardan avec accessoires Opel Vectra C 401628782494
  1423. Vase opaline XIX 19%C3%A8 si%C3%A8cle 142707085183
  1424. Ultra Fin Transparent %C3%89tui en Gel TPU Housse 332951118306
  1425. Ancien Original Coquetier En Opaline Opalex Motif 123558653667
  1426. XDH8ABS Bras de liaison Suspension roue avant droit 252489424950
  1427. LOT 002 FRANCE FRANKREICH timbres ann%C3%A9es 60 neufs 391089872471
  1428. Opel Astra H ap 12 2007 401266499609
  1429. E Appert R%C3%A9guier Complice du Mar%C3%A9chal Bazaine ca1870 392086387507
  1430. 2 pieds de lampes anciens en 153322147589
  1431. AVANT statique Ceinture de s%C3%A9curit%C3%A9 pour Chrysler SOLARA 183218230386
  1432. Blanc Fossette Blanc Osier de Luxe Panier de 223205158260
  1433. Pr%C3%BCfungsfragen f%C3%BCr Buchh%C3%A4ndler de Krause Joachim Livre 123498453749
  1434. Maillot FFF %C3%89quipe de France Ext%C3%A9rieur Giroud N%C2%B09 223294292900
  1435. Ac Dc High Voltage Album Logo T Shirt 413590621279
  1436. BATTERIA ELEKTRA YTZ14S BS BENELLI TNT Sport 1130 2005 111643308523
  1437. Microclimate Pulse B2 Green 600W Reptile Thermostat 142998705344
  1438. JOURNAL TINTIN 29 Belge 1947 2%C3%A8me Ann%C3%A9e Couverture 173582239474
  1439. Kenwood MP3 Bluetooth DAB USB CD Autoradio f%C3%BCr 392084850760
  1440. 34796 Les MacLeods Tome 3 La fiert%C3%A9 391976378055
  1441. 10Cc Dare You Japan Box Set 9 Replica 390304468407
  1442. Maquette dune presse Riviere Casalis KR au 1 32e 253954304879
  1443. 2 Ampoules Led Alfa Romeo 147 Bax9S H6W 382040074699
  1444. Vase verre %C3%A9maill%C3%A9 Legras Montjoye %C3%A9poque art 264107311245
  1445. Ball Michael Love Changes Everything The Essentia 302597236976
  1446. Kids Electronic Dj Style Music Play Mat Musical 113262123590
  1447. Coil Spring for VWSEAT GOLF IV1J1AGRALHAKLAEHAPFAHFASVAGPAQMAHWAKQ 113461868513
  1448. Coffret DVD les Goonies Gremlins lAventure 262797233825
  1449. BNWT NEXT BABY GIRLS GREEN FLORAL DRESS 3 6 452940595550
  1450. 12V Portable Car Vacuum Cleaner Hand Held Wet 323611399558
  1451. Jeu Playstation 3 Pro Evolution Soccer 2010 253242397401
  1452. Moi Moche et M%C3%A9chant Coffret 3 DVD 292820434896
  1453. AC DC Classic Logo Burnout T Shirt Neuf 112633915757
  1454. Premium Gold HDMI Cable V14 Ultra High Speed 453205261913
  1455. Fits Kia Picanto Mk1 04 11 True Leather Steering 282367314104
  1456. PEPSI Promo Music Video CD VCD Janet Jackson 163445813216
  1457. Verre %C3%A0 Moutarde Les Poucetofs n%C2%B01 ORTF 292337747821
  1458. 6x Fits BMW 3 Series E46 320i Genuine 361601115055
  1459. Alfa Romeo Mito 14 Benz 3P 5M 99Kw 283135662463
  1460. Exxtreme Power Caps Pour Homme 5 Caps 142990052878
  1461. A3 A4 A6 19 20Tdi Alternator 300577827827
  1462. Real Amour Acier Inoxydable Couple Cordiforme Bagu%C3%A9 Fian%C3%A7ailles 550552578563
  1463. 5X Ampoule LED puce 100W 7500LM Lumiere Blanche 312281175907
  1464. correspond %C3%A0 VOLVO 2 x Hid X%C3%A9non Phare 323271801401
  1465. 1Pair Banana Plug To Test Hook Clip Probe 173314508657
  1466. 6L LIQUI MOLY MOTOR %C3%96L 5W 30 SCT FILTER Peugeot 806 221 401623615462
  1467. Hellboy BLU RAY NEUF 163377856255
  1468. la grande muraille fkkt
  1469. Lego Star Wars Figur Clone Elite ARF 292868745568
  1470. Batteria Auto Bosch 0092S40300 40Ah 330A Chevrolet 222631257764
  1471. Hommes LEVI 501 Original Levis Strauss Shrink To Fit 5010226 192688423249
  1472. Pompe a carburant Lexus GS 300 IS SC430 112493935304
  1473. 1m 32mm diam%C3%A8tre tuyau durite de carburant gasoil 112213805072
  1474. Toxic Crusaders DVD 362519488083
  1475. Antique Art Deco Sterling Silver Stone Ring Ancienne 362506409922
  1476. USB Secours Chargeur de Batterie T%C3%A9l%C3%A9phone Portable 2X 192351488576
  1477. Carte Yu Gi Oh AQUACTRICE AROWANA DRL2 FR041 x 172469947743
  1478. I Left My Heart In San Francisco 272649381133
  1479. Lot De 3 Dvd Avec Jean Reno 153287336754
  1480. Slifer The Sky Dragon x 3 Secret 202443561320
  1481. C ROUGE XIII MYSTERY 10 LES 3 201931154972
  1482. Paul McCartney Wings jet let me 192712400358
  1483. Front Flat Aero Wiper Blades 24 18 292446575398
  1484. Citroen C5 Hayon 04 08 ATTELAGE crochet %C2%ABcol de 291289076958
  1485. Plaqu%C3%A9 or 4 Pole 25mm Jack St%C3%A9r%C3%A9o Audio 183528850115
  1486. Double Dragon II 2 The Revenge Nintendo 123288366334
  1487. Peter Sellers Best Of SellersThe CD 253199482777
  1488. Kato Hd 850G Excavatrice Hydraulique Shinsei Mini Power 253696393186
  1489. feu de Recul Ampoule 15 SMD LED W16W 372291162117
  1490. Pcs3 Diam%C3%A8tre 40 Mm Fil En Laiton Tube 273417803403
  1491. Front Delphi Brake Pads Brake Discs Axle 282922320785
  1492. CD Livre Johnny Hallyday Mon Pays Cest LAmourNeuf Blister 292893881941
  1493. 2 Ampoules Led Alfa Romeo 166 Bax9S H6W 252860589392
  1494. 10 Euros Mayotte Monuments Argent Des Regions 2011 223302323151
  1495. Stamp Timbre France Classique Oblitere N%C2%B0 14 142953815830
  1496. Support pare brise pour 50inch incurv%C3%A9e LED Light bar 113169103093
  1497. Coppia Ammortizzatori Anteriori Vw Golf Iv 1J1 14 292726089003
  1498. New Replacement Genuine AJP Adaptor for ACER ASPIRE 201878725644
  1499. Skf Radlagersatz Hinten Bmw 503718 323269362519
  1500. Hommes Tartan %C3%A0 Carreaux T Shirt Crosshatch Col Chemise 424020609901
  1501. Abraham Cloud Another Successful Breakfast New Cd 292895914888
  1502. PS2 GTA Grand Theft Auto Vice City OVP 282679380828
  1503. 12V 65W Portable Handheld Wet Dry Dual use 113037824059
  1504. PEPE JEANS LONDON Robe bandeau imprim%C3%A9 allover %C3%A9l%C3%A9gant 173696206602
  1505. Stylo Retouche Toyota 4U2 BROWN MICA MET 182755204394
  1506. 12 point boulon dabre de transmission Jeep Grand 273476302164
  1507. Uusica Gregoriana UK Import von Various CD 123497584110
  1508. Robe BERSHKA Taille 36 T1 S 202327507599
  1509. ancienne poign%C3%A9e bouton de porte fen%C3%AAtre laiton MASSIF 163435421268
  1510. KATE BUSH THE RED SHOES UK 153054057184
  1511. gilet de s%C3%A9curit%C3%A9 orange Taille r%C3%A9glable de M 332897208922
  1512. Santos Y Mayor 9B Naturelle Guitare 4 4 143043207330
  1513. Arrow Reflex 20 Ligne Compl%C3%A8te DEchappement Racing Honda 112645261955
  1514. Plaquette De Frein Arri%C3%A8re Sinter Ebc Fa174Hh Suzuki 401654755757
  1515. HM Faux Fur Oversized Pile Teddy Coat 153288750348
  1516. 35 mm sans fil r%C3%A9cepteur embarqu%C3%A9 de la 292829131731
  1517. poup%C3%A9e en tissu FRAISE robe faite %C3%A0 631273413995
  1518. 2X Febi Bilstein Ball Joint Lower Front Opel 372023485889
  1519. 2 Ampoules Led Alfa Romeo 166 Bax9S H6W 382039704542
  1520. Faro Proiettore Dx Depo Mercedes Classe E W211 252718603978
  1521. Alt aber bezahlt Metallic Glitzer Blau Auto Aufkleber 173506974280
  1522. ESPRIT A Linien Kleid blassblau Webmuster Casual Look Damen Gr 382677275611
  1523. Mini %CE%A671mm Super Metal fort Klaxon %C3%A9lectrique %C3%A9tanche 223221885393
  1524. lot 2 OUTIL ANCIEN CLE A MOLETTE N%C2%B0 273542825467
  1525. 20 inch AXE CF1 5x108 ET25 9J BLACK 332836862174
  1526. Ensemble 2 pieces Olga Set XXL XXXL 223070176143
  1527. Sac Bourse aumoni%C3%A8re 19e si%C3%A8cle d%C3%A9but 201573292032